BLASTX nr result
ID: Wisteria21_contig00024924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00024924 (239 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36006.1| unknown [Lotus japonicus] 59 2e-06 gb|KRH28420.1| hypothetical protein GLYMA_11G052200 [Glycine max] 58 2e-06 ref|XP_007156761.1| hypothetical protein PHAVU_002G015300g [Phas... 58 2e-06 ref|XP_003539328.1| PREDICTED: microtubule-associated protein RP... 58 2e-06 ref|XP_003517319.1| PREDICTED: microtubule-associated protein RP... 58 2e-06 gb|ACU19054.1| unknown [Glycine max] 58 2e-06 ref|XP_014520102.1| PREDICTED: microtubule-associated protein RP... 57 4e-06 gb|KOM44991.1| hypothetical protein LR48_Vigan06g029700 [Vigna a... 57 4e-06 >gb|AFK36006.1| unknown [Lotus japonicus] Length = 327 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 239 TNFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 +N +FDAAG+ +LSPRQRLSDVSDVH +ESPLM C Sbjct: 293 SNLEFDAAGVKNLSPRQRLSDVSDVHCSESPLMTC 327 >gb|KRH28420.1| hypothetical protein GLYMA_11G052200 [Glycine max] Length = 376 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 236 NFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 N DFD AG+ +LSPRQRLSDVSDVH +ESPLM C Sbjct: 343 NIDFDVAGLATLSPRQRLSDVSDVHCSESPLMTC 376 >ref|XP_007156761.1| hypothetical protein PHAVU_002G015300g [Phaseolus vulgaris] gi|561030176|gb|ESW28755.1| hypothetical protein PHAVU_002G015300g [Phaseolus vulgaris] Length = 326 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 239 TNFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 +N DFDAAGI +LSPRQRLSDVSDVH + SPLM C Sbjct: 292 SNIDFDAAGIATLSPRQRLSDVSDVHCSGSPLMTC 326 >ref|XP_003539328.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Glycine max] gi|734351939|gb|KHN12961.1| Microtubule-associated protein RP/EB family member 1 [Glycine soja] Length = 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 236 NFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 N DFD AG+ +LSPRQRLSDVSDVH +ESPLM C Sbjct: 296 NIDFDVAGLATLSPRQRLSDVSDVHCSESPLMTC 329 >ref|XP_003517319.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Glycine max] gi|734411876|gb|KHN36262.1| Microtubule-associated protein RP/EB family member 1 [Glycine soja] gi|947129203|gb|KRH77057.1| hypothetical protein GLYMA_01G190000 [Glycine max] Length = 327 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 236 NFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 N DFD AG+ +LSPRQRLSDVSDVH +ESPLM C Sbjct: 294 NIDFDVAGLATLSPRQRLSDVSDVHCSESPLMTC 327 >gb|ACU19054.1| unknown [Glycine max] Length = 327 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 236 NFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 N DFD AG+ +LSPRQRLSDVSDVH +ESPLM C Sbjct: 294 NIDFDVAGLATLSPRQRLSDVSDVHCSESPLMTC 327 >ref|XP_014520102.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Vigna radiata var. radiata] Length = 325 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 236 NFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 N DFDAAGI +LSPRQRLSD+SDVH + SPLM C Sbjct: 292 NIDFDAAGIATLSPRQRLSDISDVHCSGSPLMTC 325 >gb|KOM44991.1| hypothetical protein LR48_Vigan06g029700 [Vigna angularis] Length = 325 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 236 NFDFDAAGITSLSPRQRLSDVSDVHFNESPLMPC 135 N DFDAAGI +LSPRQRLSD+SDVH + SPLM C Sbjct: 292 NIDFDAAGIATLSPRQRLSDISDVHCSGSPLMTC 325