BLASTX nr result
ID: Wisteria21_contig00024881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00024881 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHM99552.1| hypothetical protein glysoja_006395, partial [Gly... 76 1e-11 ref|XP_007146495.1| hypothetical protein PHAVU_006G045500g, part... 67 7e-09 >gb|KHM99552.1| hypothetical protein glysoja_006395, partial [Glycine soja] Length = 78 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/49 (77%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = -2 Query: 166 SLNTPWLCLSFAVA-SLNPQNPKTLYAMVMFVSSEIGRSIKQKNPRASN 23 SL +PWLCLSFAVA SL+PQNPK+LYAMVMF SEIGRS K KNPRA++ Sbjct: 12 SLISPWLCLSFAVAVSLSPQNPKSLYAMVMFACSEIGRSTKPKNPRATS 60 >ref|XP_007146495.1| hypothetical protein PHAVU_006G045500g, partial [Phaseolus vulgaris] gi|561019718|gb|ESW18489.1| hypothetical protein PHAVU_006G045500g, partial [Phaseolus vulgaris] Length = 61 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/47 (70%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -2 Query: 151 WLCLSFAVA-SLNPQNPKTLYAMVMFVSSEIGRSIKQKNPRASNSKA 14 WLCLSFAVA S P +PK+LYAMVMF SEIGRS + +NPRASNS++ Sbjct: 15 WLCLSFAVAVSQIPHSPKSLYAMVMFACSEIGRSTRPRNPRASNSRS 61