BLASTX nr result
ID: Wisteria21_contig00024494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00024494 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD28496.1| Polynucleotidyl transferase, Ribonuclease H fold ... 61 4e-07 gb|ABN09044.1| Ribonuclease H [Medicago truncatula] 52 6e-06 >gb|ABD28496.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 126 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -1 Query: 251 GGVGISNILHVEIMALFLGIQICWEEGYKHVDCYSDSIQVIQLPQGNFQQQHH 93 G VGISNILH EI L +GI++CWE GY+ + C+ DSI V++L + + HH Sbjct: 46 GSVGISNILHAEIQTL-IGIKLCWETGYRKLMCFFDSIHVVELVMKDISRFHH 97 >gb|ABN09044.1| Ribonuclease H [Medicago truncatula] Length = 235 Score = 52.0 bits (123), Expect(2) = 6e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = -1 Query: 230 ILHVEIMALFLGIQICWEEGYKHVDCYSDSIQVIQLPQGNFQQQH 96 ILHVEI L+ G+++CW+ G KHV C+SDS V+ L Q + H Sbjct: 119 ILHVEISGLYHGLKLCWDIGIKHVVCHSDSTTVVDLVQKDLNVHH 163 Score = 24.6 bits (52), Expect(2) = 6e-06 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 84 TYREGN*CANFLAKIGTGINDKFVVLHE 1 T EGN A+FLAK G + V+L+E Sbjct: 187 TLCEGNAAADFLAKKGALSDTSLVILNE 214