BLASTX nr result
ID: Wisteria21_contig00022725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00022725 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013454530.1| transmembrane protein, putative [Medicago tr... 67 4e-09 >ref|XP_013454530.1| transmembrane protein, putative [Medicago truncatula] gi|657386197|gb|KEH28561.1| transmembrane protein, putative [Medicago truncatula] Length = 129 Score = 67.4 bits (163), Expect = 4e-09 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%) Frame = -1 Query: 309 MRVRFLTLFIVVLCTQAISSMGLQRNFSLEQRGLNSSKSNMQTKQP---IRNYGSIQEAI 139 MRVRFLT FI VLCTQAIS +G FS E R LNSS +++QTKQP + NYGSI+E I Sbjct: 1 MRVRFLTCFIAVLCTQAISILG----FSSEHRALNSSNTSIQTKQPTSNVGNYGSIKEGI 56