BLASTX nr result
ID: Wisteria21_contig00022068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00022068 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN05875.1| Tetratricopeptide repeat protein 7A [Glycine soja] 58 2e-06 ref|XP_006588689.1| PREDICTED: tetratricopeptide repeat protein ... 58 2e-06 >gb|KHN05875.1| Tetratricopeptide repeat protein 7A [Glycine soja] Length = 714 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -1 Query: 291 NVKGWLLLAWILSAQQQFLDVEYGINTAVDQIAKWDILDKDGDL 160 NVKGWLLLA ILSAQ+QFLD E +NTA+DQ KWD GDL Sbjct: 475 NVKGWLLLARILSAQKQFLDAESIVNTALDQTGKWD----QGDL 514 >ref|XP_006588689.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Glycine max] gi|947083504|gb|KRH32225.1| hypothetical protein GLYMA_10G039200 [Glycine max] gi|947083505|gb|KRH32226.1| hypothetical protein GLYMA_10G039200 [Glycine max] gi|947083506|gb|KRH32227.1| hypothetical protein GLYMA_10G039200 [Glycine max] Length = 714 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -1 Query: 291 NVKGWLLLAWILSAQQQFLDVEYGINTAVDQIAKWDILDKDGDL 160 NVKGWLLLA ILSAQ+QFLD E +NTA+DQ KWD GDL Sbjct: 475 NVKGWLLLARILSAQKQFLDAESIVNTALDQTGKWD----QGDL 514