BLASTX nr result
ID: Wisteria21_contig00021548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00021548 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH07584.1| hypothetical protein GLYMA_16G0960001, partial [G... 117 4e-24 ref|XP_006599244.1| PREDICTED: membrane-bound transcription fact... 117 4e-24 ref|XP_013446227.1| membrane-bound transcription factor site 2 p... 116 6e-24 ref|XP_013446226.1| membrane-bound transcription factor site 2 p... 116 6e-24 ref|XP_003628964.2| membrane-bound transcription factor site 2 p... 116 6e-24 gb|AFK43361.1| unknown [Medicago truncatula] 116 6e-24 ref|XP_012573793.1| PREDICTED: membrane-bound transcription fact... 115 2e-23 ref|XP_004509614.1| PREDICTED: membrane-bound transcription fact... 115 2e-23 ref|XP_007156296.1| hypothetical protein PHAVU_003G274600g [Phas... 112 1e-22 ref|XP_014506125.1| PREDICTED: membrane-bound transcription fact... 104 2e-20 gb|KJB81030.1| hypothetical protein B456_013G126100 [Gossypium r... 89 1e-15 ref|XP_012465090.1| PREDICTED: membrane-bound transcription fact... 89 1e-15 ref|XP_007031009.1| Protease m50 membrane-bound transcription fa... 87 4e-15 ref|XP_011022281.1| PREDICTED: membrane-bound transcription fact... 85 2e-14 ref|XP_011022279.1| PREDICTED: membrane-bound transcription fact... 85 2e-14 ref|XP_011020954.1| PREDICTED: membrane-bound transcription fact... 82 1e-13 ref|XP_009368586.1| PREDICTED: membrane-bound transcription fact... 82 2e-13 ref|XP_008383231.1| PREDICTED: membrane-bound transcription fact... 80 6e-13 ref|XP_012075584.1| PREDICTED: membrane-bound transcription fact... 80 8e-13 ref|XP_012075582.1| PREDICTED: membrane-bound transcription fact... 80 8e-13 >gb|KRH07584.1| hypothetical protein GLYMA_16G0960001, partial [Glycine max] Length = 338 Score = 117 bits (292), Expect = 4e-24 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFPN LERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSL+ Sbjct: 253 QPRWGPQIVAYFPNLLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLS 310 >ref|XP_006599244.1| PREDICTED: membrane-bound transcription factor site-2 protease [Glycine max] gi|734366544|gb|KHN18065.1| Membrane-bound transcription factor site-2 protease [Glycine soja] Length = 539 Score = 117 bits (292), Expect = 4e-24 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFPN LERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSL+ Sbjct: 454 QPRWGPQIVAYFPNLLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLS 511 >ref|XP_013446227.1| membrane-bound transcription factor site 2 protease [Medicago truncatula] gi|657374729|gb|KEH20254.1| membrane-bound transcription factor site 2 protease [Medicago truncatula] Length = 310 Score = 116 bits (291), Expect = 6e-24 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFPNFLER LIWTFH+SLALALLNGLPVYFLDGESILDATLSH+TSL+ Sbjct: 225 QPRWGPKIVAYFPNFLERFLIWTFHISLALALLNGLPVYFLDGESILDATLSHYTSLS 282 >ref|XP_013446226.1| membrane-bound transcription factor site 2 protease [Medicago truncatula] gi|657374728|gb|KEH20253.1| membrane-bound transcription factor site 2 protease [Medicago truncatula] Length = 389 Score = 116 bits (291), Expect = 6e-24 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFPNFLER LIWTFH+SLALALLNGLPVYFLDGESILDATLSH+TSL+ Sbjct: 304 QPRWGPKIVAYFPNFLERFLIWTFHISLALALLNGLPVYFLDGESILDATLSHYTSLS 361 >ref|XP_003628964.2| membrane-bound transcription factor site 2 protease [Medicago truncatula] gi|657374727|gb|AET03440.2| membrane-bound transcription factor site 2 protease [Medicago truncatula] Length = 537 Score = 116 bits (291), Expect = 6e-24 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFPNFLER LIWTFH+SLALALLNGLPVYFLDGESILDATLSH+TSL+ Sbjct: 452 QPRWGPKIVAYFPNFLERFLIWTFHISLALALLNGLPVYFLDGESILDATLSHYTSLS 509 >gb|AFK43361.1| unknown [Medicago truncatula] Length = 537 Score = 116 bits (291), Expect = 6e-24 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFPNFLER LIWTFH+SLALALLNGLPVYFLDGESILDATLSH+TSL+ Sbjct: 452 QPRWGPKIVAYFPNFLERFLIWTFHISLALALLNGLPVYFLDGESILDATLSHYTSLS 509 >ref|XP_012573793.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog isoform X2 [Cicer arietinum] Length = 542 Score = 115 bits (287), Expect = 2e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 378 PRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 P WGP+IVAYFPNF+ERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSL+ Sbjct: 458 PHWGPKIVAYFPNFIERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLS 514 >ref|XP_004509614.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog isoform X1 [Cicer arietinum] Length = 543 Score = 115 bits (287), Expect = 2e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -1 Query: 378 PRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 P WGP+IVAYFPNF+ERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSL+ Sbjct: 459 PHWGPKIVAYFPNFIERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLS 515 >ref|XP_007156296.1| hypothetical protein PHAVU_003G274600g [Phaseolus vulgaris] gi|561029650|gb|ESW28290.1| hypothetical protein PHAVU_003G274600g [Phaseolus vulgaris] Length = 545 Score = 112 bits (280), Expect = 1e-22 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWGP+IVAYFP+ LERILIWTFH SLALALLNGLPVYFLDGESILDATLSH+TSL+ Sbjct: 455 QPRWGPQIVAYFPSILERILIWTFHASLALALLNGLPVYFLDGESILDATLSHYTSLS 512 >ref|XP_014506125.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog [Vigna radiata var. radiata] Length = 545 Score = 104 bits (260), Expect = 2e-20 Identities = 49/59 (83%), Positives = 52/59 (88%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLNS 205 QPRWGP+IVAYFP+ LERILIWTFH SLALAL N LPVY LDGE ILDATL HFTSL+S Sbjct: 455 QPRWGPQIVAYFPSILERILIWTFHTSLALALFNALPVYLLDGEYILDATLCHFTSLSS 513 >gb|KJB81030.1| hypothetical protein B456_013G126100 [Gossypium raimondii] Length = 509 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/59 (72%), Positives = 48/59 (81%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLNS 205 QPRWG + Y PN LE+ LI TFH+SLALALLN LPVYFLDGESIL+ LSHFTSL+S Sbjct: 439 QPRWGVFLSKYLPNKLEKSLICTFHISLALALLNSLPVYFLDGESILEVALSHFTSLSS 497 >ref|XP_012465090.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog [Gossypium raimondii] gi|763814177|gb|KJB81029.1| hypothetical protein B456_013G126100 [Gossypium raimondii] Length = 528 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/59 (72%), Positives = 48/59 (81%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLNS 205 QPRWG + Y PN LE+ LI TFH+SLALALLN LPVYFLDGESIL+ LSHFTSL+S Sbjct: 439 QPRWGVFLSKYLPNKLEKSLICTFHISLALALLNSLPVYFLDGESILEVALSHFTSLSS 497 >ref|XP_007031009.1| Protease m50 membrane-bound transcription factor site 2 protease, putative [Theobroma cacao] gi|508719614|gb|EOY11511.1| Protease m50 membrane-bound transcription factor site 2 protease, putative [Theobroma cacao] Length = 532 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWG + Y PN LE+ LI TFHVSL LALLN LPVYFLDGESIL+ TLSHFTSL+ Sbjct: 443 QPRWGIFLGEYLPNKLEKSLICTFHVSLTLALLNSLPVYFLDGESILEVTLSHFTSLS 500 >ref|XP_011022281.1| PREDICTED: membrane-bound transcription factor site-2 protease-like isoform X3 [Populus euphratica] Length = 403 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWG A+ PN LE+ L++TFHVSL LALLN LPVYFLDGESIL+ L HFTSL+ Sbjct: 315 QPRWGFSFSAHLPNILEKSLMYTFHVSLTLALLNSLPVYFLDGESILEVALCHFTSLS 372 >ref|XP_011022279.1| PREDICTED: membrane-bound transcription factor site-2 protease-like isoform X1 [Populus euphratica] Length = 538 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/58 (68%), Positives = 46/58 (79%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWG A+ PN LE+ L++TFHVSL LALLN LPVYFLDGESIL+ L HFTSL+ Sbjct: 450 QPRWGFSFSAHLPNILEKSLMYTFHVSLTLALLNSLPVYFLDGESILEVALCHFTSLS 507 >ref|XP_011020954.1| PREDICTED: membrane-bound transcription factor site-2 protease-like isoform X1 [Populus euphratica] Length = 539 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 QPRWG A PN LE+ L++TFHVSL LALLN LPVYFLDGESIL+ L HFTS++ Sbjct: 450 QPRWGFSFSARLPNILEKSLMYTFHVSLTLALLNSLPVYFLDGESILEVALCHFTSVS 507 >ref|XP_009368586.1| PREDICTED: membrane-bound transcription factor site-2 protease [Pyrus x bretschneideri] Length = 534 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/57 (70%), Positives = 44/57 (77%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSL 211 +PRW +V Y PN LERILI TF VSL LALLN LPVYFLDGESIL++TL HF L Sbjct: 446 RPRWAFPLVTYLPNVLERILICTFQVSLTLALLNSLPVYFLDGESILESTLCHFAFL 502 >ref|XP_008383231.1| PREDICTED: membrane-bound transcription factor site-2 protease [Malus domestica] Length = 534 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSL 211 +PRW + Y PN LERILI TF VSL LALLN LPVYFLDGESIL+ATL HF L Sbjct: 446 RPRWAFPLGTYLPNVLERILICTFQVSLTLALLNSLPVYFLDGESILEATLCHFAFL 502 >ref|XP_012075584.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog isoform X2 [Jatropha curcas] Length = 467 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 +PRW AY P LE+ LIWTF VSL LALLN LPVYFLDGESIL+A L HFT L+ Sbjct: 379 RPRWAFTSSAYLPKVLEKGLIWTFQVSLTLALLNSLPVYFLDGESILEAALCHFTLLD 436 >ref|XP_012075582.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog isoform X1 [Jatropha curcas] gi|802620481|ref|XP_012075583.1| PREDICTED: membrane-bound transcription factor site-2 protease homolog isoform X1 [Jatropha curcas] Length = 540 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = -1 Query: 381 QPRWGPRIVAYFPNFLERILIWTFHVSLALALLNGLPVYFLDGESILDATLSHFTSLN 208 +PRW AY P LE+ LIWTF VSL LALLN LPVYFLDGESIL+A L HFT L+ Sbjct: 452 RPRWAFTSSAYLPKVLEKGLIWTFQVSLTLALLNSLPVYFLDGESILEAALCHFTLLD 509