BLASTX nr result
ID: Wisteria21_contig00021488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00021488 (221 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013445628.1| PPR containing plant protein [Medicago trunc... 82 2e-13 ref|XP_004514446.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_013463758.1| PPR containing plant protein [Medicago trunc... 79 1e-12 ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prun... 71 4e-10 ref|XP_008229148.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_011659707.1| PREDICTED: putative pentatricopeptide repeat... 69 1e-09 gb|KGN43609.1| hypothetical protein Csa_7G047440 [Cucumis sativus] 69 1e-09 ref|XP_008455539.1| PREDICTED: uncharacterized protein LOC103495... 69 2e-09 ref|XP_010099564.1| hypothetical protein L484_011570 [Morus nota... 67 7e-09 ref|XP_008381253.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 gb|KGN43610.1| hypothetical protein Csa_7G047450 [Cucumis sativus] 64 6e-08 ref|XP_012088294.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_002517926.1| pentatricopeptide repeat-containing protein,... 63 1e-07 ref|XP_008353787.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_008342918.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009357846.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_009342634.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 1e-06 ref|XP_011626188.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 ref|XP_011653157.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_009368491.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 >ref|XP_013445628.1| PPR containing plant protein [Medicago truncatula] gi|657374049|gb|KEH19654.1| PPR containing plant protein [Medicago truncatula] Length = 492 Score = 82.0 bits (201), Expect = 2e-13 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAGDP +PMT +LNQW++EGRD+NHS+LQFF+KQLR RRF AL Sbjct: 32 RISRAGDPIIPMTPILNQWIQEGRDINHSELQFFIKQLRTRRRFKQAL 79 >ref|XP_004514446.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cicer arietinum] Length = 521 Score = 81.3 bits (199), Expect = 3e-13 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAGDP +PMT +LNQW++EGRD+ S+LQFF+K+LR+YRRFN AL Sbjct: 31 RISRAGDPIIPMTPILNQWIQEGRDIKQSELQFFIKKLRSYRRFNQAL 78 >ref|XP_013463758.1| PPR containing plant protein [Medicago truncatula] gi|657398171|gb|KEH37793.1| PPR containing plant protein [Medicago truncatula] Length = 494 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/73 (52%), Positives = 46/73 (63%) Frame = -2 Query: 220 WNLYNNTXXXXXXXXXXXXXXXXXLRISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFV 41 WN YN T RISRAGDP +P+T +LNQW++EGRDV+HSD+ FF+ Sbjct: 12 WNHYNTTLLRFLHSSSTPTDTLFL-RISRAGDPIIPITSILNQWIQEGRDVSHSDIHFFI 70 Query: 40 KQLRAYRRFNHAL 2 KQLR RRF AL Sbjct: 71 KQLRIRRRFKQAL 83 >ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica] gi|462394197|gb|EMJ00101.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica] Length = 467 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAG+P V + +L+QWVEEGRDVN S+LQ FVK LR YRR++HAL Sbjct: 42 RISRAGNPRVSIAPVLDQWVEEGRDVNKSELQSFVKMLRKYRRYSHAL 89 >ref|XP_008229148.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Prunus mume] Length = 467 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAG+P V + +L+QW+EEGRDVN S+LQ FVK LR YRR++HAL Sbjct: 42 RISRAGNPRVSIVPVLDQWIEEGRDVNKSELQSFVKMLRKYRRYSHAL 89 >ref|XP_011659707.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74580 [Cucumis sativus] Length = 1022 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 R+ RAGDP + R+L+QWVEEGR VN SDLQ +KQLR + RFNHAL Sbjct: 570 RVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRTFGRFNHAL 617 >gb|KGN43609.1| hypothetical protein Csa_7G047440 [Cucumis sativus] Length = 486 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 R+ RAGDP + R+L+QWVEEGR VN SDLQ +KQLR + RFNHAL Sbjct: 41 RVYRAGDPRTSIVRVLDQWVEEGRQVNQSDLQKLIKQLRTFGRFNHAL 88 >ref|XP_008455539.1| PREDICTED: uncharacterized protein LOC103495690 [Cucumis melo] Length = 1067 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 R+ RAGDP + + R+L+QW+EEGR VN SD+Q +KQLR + RFNHAL Sbjct: 615 RVFRAGDPRISIVRVLDQWIEEGRKVNQSDIQALIKQLRKFGRFNHAL 662 >ref|XP_010099564.1| hypothetical protein L484_011570 [Morus notabilis] gi|587890992|gb|EXB79630.1| hypothetical protein L484_011570 [Morus notabilis] Length = 100 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISR GDP + + +LN W E+GRDVN +LQ +KQLR YRRF+HAL Sbjct: 37 RISRCGDPKISLIPVLNHWAEQGRDVNQPELQRIIKQLRKYRRFSHAL 84 >ref|XP_008381253.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like isoform X1 [Malus domestica] Length = 514 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAG+P V + +LNQWVEEGRDV +LQ F+K R YRR++HAL Sbjct: 42 RISRAGNPRVSVVPILNQWVEEGRDVKKWELQSFIKLFRKYRRYSHAL 89 >gb|KGN43610.1| hypothetical protein Csa_7G047450 [Cucumis sativus] Length = 493 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 R+ RAGDP + R+L+QWVEEGR V SDLQ +KQLR + RFN AL Sbjct: 41 RVYRAGDPRTSIVRVLDQWVEEGRQVKQSDLQTLIKQLRKFGRFNQAL 88 >ref|XP_012088294.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Jatropha curcas] gi|643709728|gb|KDP24137.1| hypothetical protein JCGZ_25794 [Jatropha curcas] Length = 475 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAGDP+V M +L +W+EEG D+ S+LQ F+KQLR +RR+ AL Sbjct: 40 RISRAGDPSVSMVPILEKWLEEGNDIKLSELQKFIKQLRKFRRYTQAL 87 >ref|XP_002517926.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542908|gb|EEF44444.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RIS+AG P++ + +L +W+EEG DV +LQ FVKQLR YRRF HAL Sbjct: 44 RISKAGKPSISIVPILEKWLEEGNDVKKPELQKFVKQLRKYRRFTHAL 91 >ref|XP_008353787.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like isoform X1 [Malus domestica] Length = 514 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RIS+AG+P V + +LNQWVEEGRDV +LQ F+K R +RR++HAL Sbjct: 42 RISQAGNPRVSIVPILNQWVEEGRDVKKWELQSFIKLFRKHRRYSHAL 89 >ref|XP_008342918.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like isoform X1 [Malus domestica] Length = 514 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RIS+AG+P V + +LNQWVEEGRDV +LQ F+K R +RR++HAL Sbjct: 42 RISQAGNPRVSIVPILNQWVEEGRDVKKWELQSFIKLFRKHRRYSHAL 89 >ref|XP_009357846.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Pyrus x bretschneideri] Length = 514 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRAG+P V + +LNQWVEEGR V +LQ +K R YRR++HAL Sbjct: 42 RISRAGNPRVSVVPILNQWVEEGRGVKKWELQSLIKLFRKYRRYSHAL 89 >ref|XP_009342634.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Pyrus x bretschneideri] Length = 412 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RISRA +P V + +LNQWV+EGRDV +LQ F+K R +RR++HAL Sbjct: 42 RISRARNPRVSIVPILNQWVDEGRDVKKWELQSFIKLFRKHRRYSHAL 89 >ref|XP_011626188.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Amborella trichopoda] Length = 945 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RIS GDP + LL +WV EGR V+ SDLQ VK++R YRR+ HAL Sbjct: 39 RISPLGDPGTSVVPLLEEWVREGRKVHKSDLQSLVKEMRRYRRYKHAL 86 >ref|XP_011653157.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] gi|700209576|gb|KGN64672.1| hypothetical protein Csa_1G073790 [Cucumis sativus] Length = 461 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RIS GDP + +T LL+QWV EGR V +L+ +K+LR Y+RF HAL Sbjct: 34 RISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYKRFKHAL 81 >ref|XP_009368491.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Pyrus x bretschneideri] Length = 481 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = -2 Query: 145 RISRAGDPTVPMTRLLNQWVEEGRDVNHSDLQFFVKQLRAYRRFNHAL 2 RI R+G+P V + +L+QW+EEGR+V S+LQ F+KQLR +RR+ AL Sbjct: 49 RILRSGNPRVSILPVLHQWLEEGRNVERSELQDFIKQLRKFRRYTQAL 96