BLASTX nr result
ID: Wisteria21_contig00021312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00021312 (561 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU15470.1| unknown [Glycine max] gi|734391887|gb|KHN27394.1|... 61 4e-07 ref|XP_007013320.1| Uncharacterized protein TCM_037979 [Theobrom... 60 9e-07 ref|XP_003624800.1| hypothetical protein MTR_7g087600 [Medicago ... 57 5e-06 >gb|ACU15470.1| unknown [Glycine max] gi|734391887|gb|KHN27394.1| hypothetical protein glysoja_022103 [Glycine soja] gi|947108329|gb|KRH56655.1| hypothetical protein GLYMA_05G011200 [Glycine max] Length = 70 Score = 60.8 bits (146), Expect = 4e-07 Identities = 35/64 (54%), Positives = 40/64 (62%), Gaps = 2/64 (3%) Frame = -3 Query: 547 IIAPWCNKHGNDDGVVGYDYPPAT-CNEGDAHNGNGDY-SFVPVASMEXXXXXXXXXXXY 374 +IA WC KHGNDDGV YD P AT C EG+ N +GD+ SFVPVA +E Y Sbjct: 7 VIALWCKKHGNDDGVDVYDAPAATACIEGNVCNWHGDFVSFVPVALVEGDDDDDDGGYDY 66 Query: 373 APAA 362 APAA Sbjct: 67 APAA 70 >ref|XP_007013320.1| Uncharacterized protein TCM_037979 [Theobroma cacao] gi|508783683|gb|EOY30939.1| Uncharacterized protein TCM_037979 [Theobroma cacao] Length = 239 Score = 59.7 bits (143), Expect = 9e-07 Identities = 27/52 (51%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Frame = -3 Query: 559 ISRVIIAPWCNKH--GNDDGVVGYDYPPATCNEGDAHNGNGDYSFVPVASME 410 +S+VI+A W KH G+DDG GYDY PA C EG+ + +GDY P AS+E Sbjct: 169 LSKVIVASWYKKHPDGDDDGNDGYDYAPAACIEGNGDDDDGDYDCTPAASLE 220 >ref|XP_003624800.1| hypothetical protein MTR_7g087600 [Medicago truncatula] gi|355499815|gb|AES81018.1| hypothetical protein MTR_7g087600 [Medicago truncatula] Length = 50 Score = 57.4 bits (137), Expect = 5e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = -3 Query: 547 IIAPWCNKHGND-DG-VVGYDYPPATCNEGDAHNGNGDYSFVPVA 419 ++APWC KHGND DG VV YDYPP C+EGD + +G Y + P A Sbjct: 7 VVAPWCKKHGNDHDGCVVWYDYPPTVCDEGD-DDDDGGYDYAPAA 50