BLASTX nr result
ID: Wisteria21_contig00021010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00021010 (212 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB32618.1| hypothetical protein B456_005G249200 [Gossypium r... 65 2e-08 ref|XP_012465941.1| PREDICTED: auxin-induced protein 6B-like [Go... 63 1e-07 ref|XP_008457620.1| PREDICTED: uncharacterized protein LOC103497... 62 2e-07 ref|XP_007017754.1| SAUR-like auxin-responsive protein family [T... 59 1e-06 gb|KGN60020.1| hypothetical protein Csa_3G866530 [Cucumis sativus] 59 2e-06 ref|XP_009379568.1| PREDICTED: indole-3-acetic acid-induced prot... 59 2e-06 ref|XP_008466498.1| PREDICTED: auxin-induced protein 6B [Cucumis... 59 2e-06 ref|XP_008358422.1| PREDICTED: indole-3-acetic acid-induced prot... 59 2e-06 ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus ... 59 2e-06 ref|XP_011652445.1| PREDICTED: auxin-induced protein 6B-like [Cu... 59 2e-06 ref|XP_012073829.1| PREDICTED: auxin-induced protein 6B [Jatroph... 58 2e-06 ref|XP_007201825.1| hypothetical protein PRUPE_ppa012885mg [Prun... 58 2e-06 ref|XP_011083510.1| PREDICTED: auxin-induced protein 6B-like [Se... 58 3e-06 ref|XP_009347330.1| PREDICTED: indole-3-acetic acid-induced prot... 58 3e-06 ref|XP_003523572.1| PREDICTED: indole-3-acetic acid-induced prot... 58 3e-06 ref|XP_012835744.1| PREDICTED: auxin-induced protein 6B-like [Er... 57 4e-06 ref|XP_007223677.1| hypothetical protein PRUPE_ppa012903mg [Prun... 57 4e-06 ref|XP_009378468.1| PREDICTED: indole-3-acetic acid-induced prot... 57 5e-06 ref|XP_009335244.1| PREDICTED: auxin-induced protein 10A5-like [... 57 7e-06 ref|XP_008387955.1| PREDICTED: auxin-induced protein 10A5-like [... 57 7e-06 >gb|KJB32618.1| hypothetical protein B456_005G249200 [Gossypium raimondii] Length = 206 Score = 65.5 bits (158), Expect = 2e-08 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 4/70 (5%) Frame = -2 Query: 199 TFLSFPISTPLTIFSLLFSPEKMSPATGNCSKIRHIVRVRKMLQRWRKKSGVKA----GC 32 TFLSF FS+ F +KMS TG C KIRHIVR+R+ML++WRKK+ + A G Sbjct: 37 TFLSF-------FFSVTFLRKKMSQRTGKCRKIRHIVRIRQMLKQWRKKARITANDNIGH 89 Query: 31 APLAVPAGHV 2 AP VPAG+V Sbjct: 90 APSDVPAGNV 99 >ref|XP_012465941.1| PREDICTED: auxin-induced protein 6B-like [Gossypium raimondii] gi|763746983|gb|KJB14422.1| hypothetical protein B456_002G124300 [Gossypium raimondii] Length = 150 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MSP G CSKIRHIVR+R+ML+RWR K+ V A P VPAGHV Sbjct: 1 MSPGLGKCSKIRHIVRLRQMLRRWRNKARVSASRIPSDVPAGHV 44 >ref|XP_008457620.1| PREDICTED: uncharacterized protein LOC103497270 [Cucumis melo] Length = 203 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = -2 Query: 160 FSLLFSPEK--MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLA-VPAGHV 2 FS+ FSPEK MSP T KIR IVR+R+MLQ WRKK+ V A AP + VPAGH+ Sbjct: 40 FSITFSPEKTEMSPETSKSHKIRRIVRLRQMLQHWRKKARVAASRAPPSDVPAGHI 95 >ref|XP_007017754.1| SAUR-like auxin-responsive protein family [Theobroma cacao] gi|508723082|gb|EOY14979.1| SAUR-like auxin-responsive protein family [Theobroma cacao] Length = 150 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R+ML+RWR K+ + AG P VP GHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQMLRRWRNKARMSAGRIPSDVPEGHV 44 >gb|KGN60020.1| hypothetical protein Csa_3G866530 [Cucumis sativus] Length = 200 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R+ML+RWR K+ + A P VPAGHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQMLRRWRNKARMSANRIPSDVPAGHV 44 >ref|XP_009379568.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus x bretschneideri] Length = 150 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MSPA C+K+R IVR+R+MLQRW KK+ + A AP VP+GHV Sbjct: 1 MSPAISKCNKLRRIVRIRQMLQRWHKKARLTAAPAPSDVPSGHV 44 >ref|XP_008466498.1| PREDICTED: auxin-induced protein 6B [Cucumis melo] Length = 150 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R+ML+RWR K+ + A P VPAGHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQMLRRWRNKARMSANRIPSDVPAGHV 44 >ref|XP_008358422.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus domestica] gi|658060134|ref|XP_008365899.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus domestica] Length = 146 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MSPA C+K+R IVR+R+MLQRW KK+ + A AP VP+GHV Sbjct: 1 MSPAISKCNKLRRIVRIRQMLQRWHKKARLTAARAPSDVPSGHV 44 >ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus communis] gi|223551212|gb|EEF52698.1| Auxin-induced protein 6B, putative [Ricinus communis] Length = 151 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R+ML+RWR K+ + A P VPAGHV Sbjct: 1 MSVMMGKCSKIRHIVRLRQMLRRWRNKARISANRIPSDVPAGHV 44 >ref|XP_011652445.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] Length = 150 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R+ML+RWR K+ + A P VPAGHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQMLRRWRNKARMSANRIPSDVPAGHV 44 >ref|XP_012073829.1| PREDICTED: auxin-induced protein 6B [Jatropha curcas] gi|643729008|gb|KDP36945.1| hypothetical protein JCGZ_08236 [Jatropha curcas] Length = 150 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R+ML+RWR K+ + A P VPAGHV Sbjct: 1 MSAGFGKCSKIRHIVRLRQMLRRWRNKARMSANRIPSDVPAGHV 44 >ref|XP_007201825.1| hypothetical protein PRUPE_ppa012885mg [Prunus persica] gi|645262568|ref|XP_008236819.1| PREDICTED: uncharacterized protein LOC103335585 [Prunus mume] gi|462397225|gb|EMJ03024.1| hypothetical protein PRUPE_ppa012885mg [Prunus persica] Length = 150 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MSPA C+KIR IVR+R+MLQ W KK+ + A AP VPAGHV Sbjct: 1 MSPAISKCNKIRRIVRIRQMLQSWHKKARLAAARAPSDVPAGHV 44 >ref|XP_011083510.1| PREDICTED: auxin-induced protein 6B-like [Sesamum indicum] Length = 148 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 112 CSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 CSKIRHIVR+R+ML+RWRKK+ + A AP VPAGHV Sbjct: 4 CSKIRHIVRIRQMLRRWRKKAAMAARRAPSDVPAGHV 40 >ref|XP_009347330.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus x bretschneideri] Length = 146 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MSP C+K+R IVR+R+MLQRW KK+ + A AP VP+GHV Sbjct: 1 MSPVISKCNKLRRIVRIRQMLQRWHKKARLTAASAPSDVPSGHV 44 >ref|XP_003523572.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Glycine max] gi|734431712|gb|KHN45913.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja] gi|947112757|gb|KRH61059.1| hypothetical protein GLYMA_04G025500 [Glycine max] Length = 128 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS A G CS+IRHIVR+R+ML+RWR K+ A P VPAGHV Sbjct: 1 MSAALGKCSRIRHIVRLRQMLRRWRSKARTSAHRIPSDVPAGHV 44 >ref|XP_012835744.1| PREDICTED: auxin-induced protein 6B-like [Erythranthe guttatus] gi|604334761|gb|EYU38833.1| hypothetical protein MIMGU_mgv1a021651mg [Erythranthe guttata] Length = 148 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 112 CSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 CSKIRHIVR+R+ML+RWRKK+ A AP VPAGHV Sbjct: 5 CSKIRHIVRIRQMLRRWRKKAAAAARQAPSDVPAGHV 41 >ref|XP_007223677.1| hypothetical protein PRUPE_ppa012903mg [Prunus persica] gi|645229081|ref|XP_008221296.1| PREDICTED: auxin-induced protein 6B [Prunus mume] gi|462420613|gb|EMJ24876.1| hypothetical protein PRUPE_ppa012903mg [Prunus persica] Length = 150 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R++L+RWR K+ + A P VPAGHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQLLRRWRSKARMSANRIPSDVPAGHV 44 >ref|XP_009378468.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus x bretschneideri] Length = 146 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MSP C+K+R IVR+R+MLQRW KK+ + A AP VP+GHV Sbjct: 1 MSPVISKCNKLRRIVRIRQMLQRWHKKARLTAARAPSDVPSGHV 44 >ref|XP_009335244.1| PREDICTED: auxin-induced protein 10A5-like [Pyrus x bretschneideri] Length = 150 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R++L+RWR K+ A P VPAGHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQLLRRWRSKACTSAKLIPSDVPAGHV 44 >ref|XP_008387955.1| PREDICTED: auxin-induced protein 10A5-like [Malus domestica] Length = 150 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -2 Query: 133 MSPATGNCSKIRHIVRVRKMLQRWRKKSGVKAGCAPLAVPAGHV 2 MS G CSKIRHIVR+R++L+RWR K+ A P VPAGHV Sbjct: 1 MSAGLGKCSKIRHIVRLRQLLRRWRSKACTSAKLIPSDVPAGHV 44