BLASTX nr result
ID: Wisteria21_contig00020982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00020982 (229 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN38102.1| Protein brittle-1, chloroplastic/amyloplastic [Gl... 58 2e-06 ref|XP_006585680.1| PREDICTED: probable mitochondrial adenine nu... 57 7e-06 >gb|KHN38102.1| Protein brittle-1, chloroplastic/amyloplastic [Glycine soja] Length = 378 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 190 SSKKTKSPCSVSRPRSQGKEIAKIIMALESQSQKKNYGHGVFGDVYSSIIKDMEMD 23 S+ KTK+P S+S S+ + A MALESQ QK YGHGVFGDVY SIIK+ME+D Sbjct: 4 SNSKTKTPSSLSLCNSKPQPQA-CNMALESQPQKNKYGHGVFGDVY-SIIKEMEID 57 >ref|XP_006585680.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like [Glycine max] gi|947096095|gb|KRH44680.1| hypothetical protein GLYMA_08G225000 [Glycine max] Length = 378 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -1 Query: 190 SSKKTKSPCSVSRPRSQGKEIAKIIMALESQSQKKNYGHGVFGDVYSSIIKDMEMD 23 S+ KTK+P S+S S+ + + MALESQ QK YGHGVFGDVY SIIK+ME+D Sbjct: 4 SNSKTKTPSSLSLCNSKPQP-QEGNMALESQPQKNKYGHGVFGDVY-SIIKEMEID 57