BLASTX nr result
ID: Wisteria21_contig00020934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00020934 (667 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN39194.1| hypothetical protein glysoja_027999 [Glycine soja... 71 5e-10 >gb|KHN39194.1| hypothetical protein glysoja_027999 [Glycine soja] gi|947093625|gb|KRH42210.1| hypothetical protein GLYMA_08G075800 [Glycine max] Length = 114 Score = 71.2 bits (173), Expect = 5e-10 Identities = 38/76 (50%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = -1 Query: 451 HCTQYAYHSCFL-HGALMEGGSFFYDCGTLVGRS**VEQLQSIVFIHYCSIWWKIALIEP 275 +CTQ F GAL+EG F +G + ++F+H CS+WWKIALIE Sbjct: 37 NCTQICIPLLFSSRGALIEGVPFSMIVALCLGDLDALSNYDPLLFLHCCSMWWKIALIEH 96 Query: 274 FTCLHVMFCLPRSSLS 227 FTCLHVMFCL RSSLS Sbjct: 97 FTCLHVMFCLLRSSLS 112