BLASTX nr result
ID: Wisteria21_contig00020789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00020789 (611 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH05836.1| hypothetical protein GLYMA_17G251500 [Glycine max] 87 9e-15 ref|XP_006601317.1| PREDICTED: tubby-like F-box protein 5-like i... 85 4e-14 ref|XP_006601316.1| PREDICTED: tubby-like F-box protein 5-like i... 84 8e-14 gb|KHN12701.1| Tubby-like F-box protein 5 [Glycine soja] 75 2e-11 ref|XP_003550385.1| PREDICTED: tubby-like F-box protein 5-like i... 75 2e-11 ref|XP_003544406.1| PREDICTED: tubby-like F-box protein 5-like i... 75 2e-11 ref|XP_013466123.1| tubby-F-box-like protein [Medicago truncatul... 74 5e-11 gb|KOM49157.1| hypothetical protein LR48_Vigan07g286100 [Vigna a... 74 6e-11 ref|XP_007160744.1| hypothetical protein PHAVU_001G013500g [Phas... 74 6e-11 ref|XP_014504786.1| PREDICTED: tubby-like F-box protein 5 [Vigna... 73 1e-10 ref|XP_004499167.1| PREDICTED: tubby-like F-box protein 5 [Cicer... 73 1e-10 ref|XP_003589399.2| tubby-F-box-like protein [Medicago truncatul... 69 2e-09 >gb|KRH05836.1| hypothetical protein GLYMA_17G251500 [Glycine max] Length = 452 Score = 86.7 bits (213), Expect = 9e-15 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -3 Query: 192 IVSPTSPIIMPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 ++S T+PIIMPF+SIVR+LKE+GEGI NMYRR EAKH +HRHGKSHIAPEC Sbjct: 8 LISSTTPIIMPFRSIVRELKEIGEGISNMYRRGGEAKH-VHRHGKSHIAPEC 58 >ref|XP_006601317.1| PREDICTED: tubby-like F-box protein 5-like isoform X3 [Glycine max] gi|947056385|gb|KRH05838.1| hypothetical protein GLYMA_17G251500 [Glycine max] Length = 448 Score = 84.7 bits (208), Expect = 4e-14 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -3 Query: 192 IVSPTSPIIMPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 I S T+PIIMPF+SIVR+LKE+GEGI NMYRR EAKH +HRHGKSHIAPEC Sbjct: 4 IPSITTPIIMPFRSIVRELKEIGEGISNMYRRGGEAKH-VHRHGKSHIAPEC 54 >ref|XP_006601316.1| PREDICTED: tubby-like F-box protein 5-like isoform X2 [Glycine max] gi|947056384|gb|KRH05837.1| hypothetical protein GLYMA_17G251500 [Glycine max] Length = 454 Score = 83.6 bits (205), Expect = 8e-14 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 180 TSPIIMPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 T+PIIMPF+SIVR+LKE+GEGI NMYRR EAKH +HRHGKSHIAPEC Sbjct: 14 TTPIIMPFRSIVRELKEIGEGISNMYRRGGEAKH-VHRHGKSHIAPEC 60 >gb|KHN12701.1| Tubby-like F-box protein 5 [Glycine soja] Length = 436 Score = 75.5 bits (184), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPF+SIVR+LKE+GEGI NMYRR EAKH +HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRRGGEAKH-VHRHGKSHIAPEC 42 >ref|XP_003550385.1| PREDICTED: tubby-like F-box protein 5-like isoform X1 [Glycine max] gi|947056386|gb|KRH05839.1| hypothetical protein GLYMA_17G251500 [Glycine max] Length = 436 Score = 75.5 bits (184), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPF+SIVR+LKE+GEGI NMYRR EAKH +HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRRGGEAKH-VHRHGKSHIAPEC 42 >ref|XP_003544406.1| PREDICTED: tubby-like F-box protein 5-like isoform X1 [Glycine max] gi|571507973|ref|XP_006595928.1| PREDICTED: tubby-like F-box protein 5-like isoform X2 [Glycine max] gi|571507976|ref|XP_006595929.1| PREDICTED: tubby-like F-box protein 5-like isoform X3 [Glycine max] gi|571507979|ref|XP_006595930.1| PREDICTED: tubby-like F-box protein 5-like isoform X4 [Glycine max] gi|734375427|gb|KHN20970.1| Tubby-like F-box protein 5 [Glycine soja] gi|947066036|gb|KRH15179.1| hypothetical protein GLYMA_14G073500 [Glycine max] gi|947066037|gb|KRH15180.1| hypothetical protein GLYMA_14G073500 [Glycine max] Length = 423 Score = 75.5 bits (184), Expect = 2e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPF+SIVR+LKE+GEGI NMYRR EAKH +HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRRGGEAKH-VHRHGKSHIAPEC 42 >ref|XP_013466123.1| tubby-F-box-like protein [Medicago truncatula] gi|657401142|gb|KEH40162.1| tubby-F-box-like protein [Medicago truncatula] Length = 422 Score = 74.3 bits (181), Expect = 5e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPFKSIV++LKE+ EGIGNMYRR E KH MHRHGKSHIAPEC Sbjct: 1 MPFKSIVKELKEMKEGIGNMYRRGVETKH-MHRHGKSHIAPEC 42 >gb|KOM49157.1| hypothetical protein LR48_Vigan07g286100 [Vigna angularis] Length = 434 Score = 73.9 bits (180), Expect = 6e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPF+SIVR+LKE+GEGI NMYRR E KH +HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRRGGEGKH-VHRHGKSHIAPEC 42 >ref|XP_007160744.1| hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] gi|593795414|ref|XP_007160745.1| hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] gi|561034208|gb|ESW32738.1| hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] gi|561034209|gb|ESW32739.1| hypothetical protein PHAVU_001G013500g [Phaseolus vulgaris] Length = 429 Score = 73.9 bits (180), Expect = 6e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPF+SIVR+LKE+GEGI NMYRR E KH +HRHGKSHIAPEC Sbjct: 1 MPFRSIVRELKEIGEGISNMYRRGGEGKH-VHRHGKSHIAPEC 42 >ref|XP_014504786.1| PREDICTED: tubby-like F-box protein 5 [Vigna radiata var. radiata] Length = 434 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPF+SI+R+LKE+GEGI NMYRR E KH +HRHGKSHIAPEC Sbjct: 1 MPFRSILRELKEIGEGISNMYRRGGEGKH-VHRHGKSHIAPEC 42 >ref|XP_004499167.1| PREDICTED: tubby-like F-box protein 5 [Cicer arietinum] gi|828309384|ref|XP_012570834.1| PREDICTED: tubby-like F-box protein 5 [Cicer arietinum] Length = 420 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 M KSIVR++KE+GEGIGNMYRR E+KH MHRHGKSHIAPEC Sbjct: 1 MSLKSIVREIKEMGEGIGNMYRRGVESKH-MHRHGKSHIAPEC 42 >ref|XP_003589399.2| tubby-F-box-like protein [Medicago truncatula] gi|657401195|gb|AES59650.2| tubby-F-box-like protein [Medicago truncatula] Length = 159 Score = 69.3 bits (168), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 165 MPFKSIVRDLKELGEGIGNMYRRRREAKHMMHRHGKSHIAPEC 37 MPFKSIVR++KE+ EGIGNMY R E KH HRHGKSHIAPEC Sbjct: 1 MPFKSIVREIKEMKEGIGNMYIRDVETKH-THRHGKSHIAPEC 42