BLASTX nr result
ID: Wisteria21_contig00020524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00020524 (332 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB44081.1| hypothetical protein B456_007G233400 [Gossypium r... 64 4e-08 >gb|KJB44081.1| hypothetical protein B456_007G233400 [Gossypium raimondii] Length = 356 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 201 MSLRPNVPHSCSIAFGLHSHLLVSSEMNPNSN 106 MS RPNVPHS SIAFGLHSHLLVSSEMNPNSN Sbjct: 1 MSQRPNVPHSSSIAFGLHSHLLVSSEMNPNSN 32