BLASTX nr result
ID: Wisteria21_contig00020364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00020364 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN35970.1| Protein GRIP [Glycine soja] 88 2e-15 >gb|KHN35970.1| Protein GRIP [Glycine soja] Length = 828 Score = 88.2 bits (217), Expect = 2e-15 Identities = 55/113 (48%), Positives = 67/113 (59%) Frame = -3 Query: 340 VTGPFRNGSVFSSPFRARRREIHFATGDLTSTGGSRIHIEQTSFF*PNLPPHPFSSTGSP 161 ++G F NGSVF SP+RARRREIH AT D TSTG SR H F Sbjct: 13 LSGTFGNGSVFYSPYRARRREIHSAT-DPTSTGTSR---------------HSFP----- 51 Query: 160 YLGNISCSLCW*NL*HKKLMASGEGDTGGMMERPAEDSSIPEEHLPEVNRQHE 2 + SLCW +L K+L+ASGEGDTGGMM+ AEDS+ EE+ P+V +E Sbjct: 52 -----TLSLCWSDLCCKRLIASGEGDTGGMMDTHAEDSARSEENFPDVTHHNE 99