BLASTX nr result
ID: Wisteria21_contig00020287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00020287 (412 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490581.1| PREDICTED: ATP-dependent zinc metalloproteas... 69 1e-09 ref|XP_003615584.1| ATP-dependent zinc metalloprotease FTSH prot... 64 6e-08 ref|XP_014504823.1| PREDICTED: ATP-dependent zinc metalloproteas... 61 3e-07 gb|KOM56870.1| hypothetical protein LR48_Vigan10g276200 [Vigna a... 61 3e-07 ref|XP_007142221.1| hypothetical protein PHAVU_008G262300g [Phas... 60 6e-07 ref|XP_007142220.1| hypothetical protein PHAVU_008G262300g [Phas... 60 6e-07 >ref|XP_004490581.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 7, chloroplastic-like [Cicer arietinum] Length = 804 Score = 68.9 bits (167), Expect = 1e-09 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -1 Query: 283 MSALDY-LSPLTHTKIYLRSYSAKSNFHHWRQNARHFVPNSVPVRALRDASFLRDSGRFD 107 MS+LDY LSPLTHT IYL S HH+R NA FVPNS P+R LR A+F +D RFD Sbjct: 1 MSSLDYYLSPLTHTTIYLHS-------HHFR-NAHRFVPNSSPIRVLRHANFFKDFKRFD 52 Query: 106 LW 101 LW Sbjct: 53 LW 54 >ref|XP_003615584.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] gi|355516919|gb|AES98542.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] Length = 793 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = -1 Query: 283 MSALDYLSPLTHTKIYLRSYSAKSNFHHWRQNARHFVPNSVPVRALRDASFLRDSGRFDL 104 MSALDYLSP TH I+L S HH+R R +PNS +R LRD+ FL + G+F+L Sbjct: 1 MSALDYLSPSTHATIFLHS-------HHFRNARRFVIPNSPSIRVLRDSIFLNNFGKFEL 53 Query: 103 W 101 W Sbjct: 54 W 54 >ref|XP_014504823.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 9, chloroplastic-like [Vigna radiata var. radiata] Length = 794 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/63 (52%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = -1 Query: 283 MSALDYL--SPLTHTKIYLRSYSAKSNFHHWRQNARHFVPNSVPVRALRDASFLRDSGRF 110 MSAL+YL SP+T+TK++L S++ + +RQN FVPNS PVR RDSGRF Sbjct: 1 MSALEYLYLSPITYTKVFLNSHNWRKPSTPFRQNTCRFVPNSAPVRV---PGVWRDSGRF 57 Query: 109 DLW 101 DLW Sbjct: 58 DLW 60 >gb|KOM56870.1| hypothetical protein LR48_Vigan10g276200 [Vigna angularis] Length = 794 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/63 (52%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = -1 Query: 283 MSALDYL--SPLTHTKIYLRSYSAKSNFHHWRQNARHFVPNSVPVRALRDASFLRDSGRF 110 MSAL+YL SP+T+TK++L S++ + +RQN FVPNS PVR RDSGRF Sbjct: 1 MSALEYLYLSPITYTKVFLNSHNWRKPSTPFRQNTCRFVPNSAPVRV---PGVWRDSGRF 57 Query: 109 DLW 101 DLW Sbjct: 58 DLW 60 >ref|XP_007142221.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris] gi|561015354|gb|ESW14215.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris] Length = 796 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = -1 Query: 283 MSALDYL--SPLTHTKIYLRSYSAKSNFHHWRQNARHFVPNSVPVRALRDASFLRDSGRF 110 MSAL+YL SPLT+TK++L S++ + +R N FVPNS PVR RDSGRF Sbjct: 1 MSALEYLYLSPLTYTKVFLNSHNWRKPSTPFRHNTCRFVPNSAPVRV---PGVWRDSGRF 57 Query: 109 DLW 101 DLW Sbjct: 58 DLW 60 >ref|XP_007142220.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris] gi|561015353|gb|ESW14214.1| hypothetical protein PHAVU_008G262300g [Phaseolus vulgaris] Length = 679 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = -1 Query: 283 MSALDYL--SPLTHTKIYLRSYSAKSNFHHWRQNARHFVPNSVPVRALRDASFLRDSGRF 110 MSAL+YL SPLT+TK++L S++ + +R N FVPNS PVR RDSGRF Sbjct: 1 MSALEYLYLSPLTYTKVFLNSHNWRKPSTPFRHNTCRFVPNSAPVRV---PGVWRDSGRF 57 Query: 109 DLW 101 DLW Sbjct: 58 DLW 60