BLASTX nr result
ID: Wisteria21_contig00019459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00019459 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN03152.1| Ribosomal RNA small subunit methyltransferase NEP... 65 2e-08 ref|XP_008218954.1| PREDICTED: ribosomal RNA small subunit methy... 64 4e-08 ref|XP_007226721.1| hypothetical protein PRUPE_ppa019713mg, part... 64 4e-08 gb|KMT10875.1| hypothetical protein BVRB_5g113720 [Beta vulgaris... 63 1e-07 ref|XP_009605733.1| PREDICTED: ribosomal RNA small subunit methy... 60 5e-07 ref|XP_009605732.1| PREDICTED: ribosomal RNA small subunit methy... 60 5e-07 ref|XP_009763268.1| PREDICTED: ribosomal RNA small subunit methy... 60 6e-07 gb|ABK22212.1| unknown [Picea sitchensis] 59 1e-06 ref|XP_006356609.1| PREDICTED: ribosomal RNA small subunit methy... 59 1e-06 ref|XP_004251974.1| PREDICTED: ribosomal RNA small subunit methy... 59 1e-06 ref|XP_009779294.1| PREDICTED: ribosomal RNA small subunit methy... 59 2e-06 ref|XP_009586732.1| PREDICTED: ribosomal RNA small subunit methy... 59 2e-06 ref|XP_009586730.1| PREDICTED: ribosomal RNA small subunit methy... 59 2e-06 ref|XP_009758136.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal RN... 57 7e-06 gb|AFK49467.1| unknown [Lotus japonicus] 57 7e-06 ref|XP_008350877.1| PREDICTED: ribosomal RNA small subunit methy... 56 9e-06 >gb|KHN03152.1| Ribosomal RNA small subunit methyltransferase NEP1 [Glycine soja] gi|947089565|gb|KRH38230.1| hypothetical protein GLYMA_09G120100 [Glycine max] Length = 121 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEAL 212 GKVK DY+HDYIS+SEYPLA KYCLGMICEAL Sbjct: 90 GKVKGDYMHDYISISEYPLAAKYCLGMICEAL 121 >ref|XP_008218954.1| PREDICTED: ribosomal RNA small subunit methyltransferase nep-1-like [Prunus mume] Length = 264 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKIF 191 GK+ ++Y D+ISVS YPL+ +YC+G+ICE+LE KWKIF Sbjct: 226 GKISKEYTDDFISVSNYPLSAQYCIGLICESLEHKWKIF 264 >ref|XP_007226721.1| hypothetical protein PRUPE_ppa019713mg, partial [Prunus persica] gi|462423657|gb|EMJ27920.1| hypothetical protein PRUPE_ppa019713mg, partial [Prunus persica] Length = 239 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKIF 191 GK+ ++Y D+ISVS YPL+ +YC+G+ICE+LE KWKIF Sbjct: 201 GKISKEYTDDFISVSNYPLSAQYCIGLICESLEHKWKIF 239 >gb|KMT10875.1| hypothetical protein BVRB_5g113720 [Beta vulgaris subsp. vulgaris] Length = 146 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 304 KVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 KV +D DYISVS YPL+ KYCLG++CEALEQKWK+ Sbjct: 107 KVSKDSTDDYISVSGYPLSAKYCLGLVCEALEQKWKL 143 >ref|XP_009605733.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like isoform X2 [Nicotiana tomentosiformis] Length = 180 Score = 60.5 bits (145), Expect = 5e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+++DYV DYISVS+YPL+ YC+ M+ A+E+KWKI Sbjct: 142 GKIEKDYVEDYISVSDYPLSAAYCISMVANAVERKWKI 179 >ref|XP_009605732.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like isoform X1 [Nicotiana tomentosiformis] Length = 205 Score = 60.5 bits (145), Expect = 5e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+++DYV DYISVS+YPL+ YC+ M+ A+E+KWKI Sbjct: 167 GKIEKDYVEDYISVSDYPLSAAYCISMVANAVERKWKI 204 >ref|XP_009763268.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana sylvestris] Length = 276 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+++DYV DYISVS+YPL+ YC+ M+ A+E+KWKI Sbjct: 238 GKIEKDYVEDYISVSDYPLSAAYCISMVTNAVERKWKI 275 >gb|ABK22212.1| unknown [Picea sitchensis] Length = 250 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ DY+ D+IS+SEYPL+ C+G IC A+EQKWKI Sbjct: 212 GKINADYIDDFISISEYPLSAACCIGRICNAVEQKWKI 249 >ref|XP_006356609.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Solanum tuberosum] Length = 278 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ +DYV DY+S+S+YPL+ YC+ MI A+E+KWKI Sbjct: 240 GKIDKDYVEDYLSISDYPLSAAYCISMITNAMERKWKI 277 >ref|XP_004251974.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1 [Solanum lycopersicum] Length = 278 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ +DYV DY+S+S+YPL+ YC+ MI A+E+KWKI Sbjct: 240 GKIDKDYVEDYLSISDYPLSAAYCISMITNAMERKWKI 277 >ref|XP_009779294.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana sylvestris] gi|698587820|ref|XP_009779295.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana sylvestris] gi|698587823|ref|XP_009779296.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana sylvestris] Length = 272 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ +DYV DY+S+S+YPL+ YC+ MI A+E+KWKI Sbjct: 234 GKIDKDYVEDYLSISDYPLSAAYCISMITNAVERKWKI 271 >ref|XP_009586732.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana tomentosiformis] Length = 276 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ +DYV DY+S+S+YPL+ YC+ MI A+E+KWKI Sbjct: 238 GKIDKDYVEDYLSISDYPLSAAYCISMITNAVERKWKI 275 >ref|XP_009586730.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana tomentosiformis] Length = 182 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ +DYV DY+S+S+YPL+ YC+ MI A+E+KWKI Sbjct: 144 GKIDKDYVEDYLSISDYPLSAAYCISMITNAVERKWKI 181 >ref|XP_009758136.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal RNA small subunit methyltransferase NEP1-like [Nicotiana sylvestris] Length = 210 Score = 56.6 bits (135), Expect = 7e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GK+ +DYV DY+S+S+YPL+ YC+ MI +E+KWKI Sbjct: 172 GKIDKDYVEDYLSISDYPLSAAYCISMITNIVERKWKI 209 >gb|AFK49467.1| unknown [Lotus japonicus] Length = 272 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKI 194 GKV+ DY DYI+VS YPL+ YC+ IC ALE KWKI Sbjct: 234 GKVETDYTEDYIAVSGYPLSAAYCITRICNALEAKWKI 271 >ref|XP_008350877.1| PREDICTED: ribosomal RNA small subunit methyltransferase NEP1-like [Malus domestica] Length = 263 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 307 GKVKRDYVHDYISVSEYPLATKYCLGMICEALEQKWKIF 191 GK+ +Y D+ISVS YPL+ K C+G+ICE+LE KWKIF Sbjct: 226 GKIN-EYTDDFISVSNYPLSAKGCIGLICESLEHKWKIF 263