BLASTX nr result
ID: Wisteria21_contig00019107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00019107 (250 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH28475.1| hypothetical protein GLYMA_11G056300 [Glycine max] 69 1e-09 ref|XP_014519512.1| PREDICTED: uncharacterized protein LOC106776... 64 6e-08 >gb|KRH28475.1| hypothetical protein GLYMA_11G056300 [Glycine max] Length = 41 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 91 MDSDRPRKPSENLVHSRFFLSGFYCWDWEF 2 MDSDRPRKPS+NLVHSRFFL GFYCWDWEF Sbjct: 1 MDSDRPRKPSKNLVHSRFFLFGFYCWDWEF 30 >ref|XP_014519512.1| PREDICTED: uncharacterized protein LOC106776546 [Vigna radiata var. radiata] Length = 41 Score = 63.5 bits (153), Expect = 6e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 91 MDSDRPRKPSENLVHSRFFLSGFYCWDWEF 2 MDSD RKPS+N +HSRFFLSGFYCWDWEF Sbjct: 1 MDSDHSRKPSKNFLHSRFFLSGFYCWDWEF 30