BLASTX nr result
ID: Wisteria21_contig00019082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00019082 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485831.1| PREDICTED: uncharacterized protein LOC101508... 92 2e-16 ref|XP_003593639.1| myosin heavy chain-like protein, putative [M... 72 1e-10 gb|KOM53749.1| hypothetical protein LR48_Vigan09g240800 [Vigna a... 58 2e-06 >ref|XP_004485831.1| PREDICTED: uncharacterized protein LOC101508896 [Cicer arietinum] Length = 276 Score = 92.0 bits (227), Expect = 2e-16 Identities = 45/58 (77%), Positives = 54/58 (93%) Frame = +3 Query: 93 MVPSVTIFLAFSSVFLLYSLLPLSAQPVNHFTSQIHQINLKIAHLESVLEETNKKLKE 266 MVPS+ IFLAFSS+FLL++ LP+SAQ ++HFTSQI+QINLKIAHLESVLEETN+ LKE Sbjct: 1 MVPSIFIFLAFSSLFLLHTSLPVSAQSIDHFTSQINQINLKIAHLESVLEETNQNLKE 58 >ref|XP_003593639.1| myosin heavy chain-like protein, putative [Medicago truncatula] gi|355482687|gb|AES63890.1| myosin heavy chain-like protein, putative [Medicago truncatula] Length = 276 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/58 (62%), Positives = 48/58 (82%) Frame = +3 Query: 93 MVPSVTIFLAFSSVFLLYSLLPLSAQPVNHFTSQIHQINLKIAHLESVLEETNKKLKE 266 MVPS+TI + ++FL+ + LP+SA+ ++ F SQI+QINLKIAHLESVLE+TNKKL E Sbjct: 1 MVPSMTITVFSLALFLVQTSLPVSAESIDQFNSQINQINLKIAHLESVLEQTNKKLTE 58 >gb|KOM53749.1| hypothetical protein LR48_Vigan09g240800 [Vigna angularis] Length = 274 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/58 (55%), Positives = 44/58 (75%) Frame = +3 Query: 93 MVPSVTIFLAFSSVFLLYSLLPLSAQPVNHFTSQIHQINLKIAHLESVLEETNKKLKE 266 ++ S+T FL LL++ L SAQP++H +I+QIN+KI+HLESVLEETNK+LKE Sbjct: 8 LLTSITAFL------LLHTSLSASAQPIHH---EINQINVKISHLESVLEETNKRLKE 56