BLASTX nr result
ID: Wisteria21_contig00018908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00018908 (316 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013425218.1| hypothetical protein M436DRAFT_65736 [Aureob... 88 3e-15 >ref|XP_013425218.1| hypothetical protein M436DRAFT_65736 [Aureobasidium namibiae CBS 147.97] gi|662513349|gb|KEQ70920.1| hypothetical protein M436DRAFT_65736 [Aureobasidium namibiae CBS 147.97] Length = 1496 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 RQYCQDESQVEKEESPKTEAQEKKDESQIQVNDSPRQLDHHGSLI 137 RQYCQDESQVEKEES +TEAQEKKDESQIQVNDSPRQLDH+GSLI Sbjct: 1452 RQYCQDESQVEKEESSQTEAQEKKDESQIQVNDSPRQLDHNGSLI 1496