BLASTX nr result
ID: Wisteria21_contig00018749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00018749 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504895.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 77 5e-12 gb|AFK48553.1| unknown [Lotus japonicus] 70 6e-10 ref|XP_003591875.1| Myb/SANT-like DNA-binding domain protein [Me... 69 2e-09 ref|XP_003617104.1| cytochrome C biogenesis protein ccsA [Medica... 68 3e-09 ref|XP_003608293.2| Myb/SANT-like DNA-binding domain protein [Me... 67 5e-09 ref|XP_003606067.2| Myb/SANT-like DNA-binding domain protein [Me... 67 5e-09 ref|XP_004504897.1| PREDICTED: F-box/LRR-repeat protein At1g5566... 65 2e-08 ref|XP_004504896.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 65 2e-08 ref|XP_004501663.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 64 4e-08 ref|XP_003608306.2| F-box/RNI superfamily protein [Medicago trun... 63 8e-08 ref|XP_013457158.1| F-box/RNI superfamily protein [Medicago trun... 63 8e-08 ref|XP_004504894.1| PREDICTED: FBD-associated F-box protein At1g... 62 1e-07 ref|XP_003629672.1| Myb/SANT-like DNA-binding domain protein [Me... 62 1e-07 ref|XP_013459827.1| F-box/RNI/FBD-like domain protein, putative ... 60 8e-07 ref|XP_013459826.1| F-box/RNI/FBD-like domain protein, putative ... 60 8e-07 ref|XP_013459825.1| F-box/RNI/FBD-like domain protein, putative ... 60 8e-07 ref|XP_013457156.1| F-box/RNI superfamily protein [Medicago trun... 59 1e-06 ref|XP_003606020.1| F-box/RNI superfamily protein [Medicago trun... 59 1e-06 ref|XP_004501665.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 59 2e-06 ref|XP_013459831.1| F-box protein, putative [Medicago truncatula... 57 4e-06 >ref|XP_004504895.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 [Cicer arietinum] Length = 427 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/57 (64%), Positives = 47/57 (82%), Gaps = 3/57 (5%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENE---DRLSDLPDCVLLHILGFLSARYAVRT 297 M++S +E+MI K KRGRH E+ENEENE DRLSDLPDC++LHIL FL+ ++AVRT Sbjct: 6 MADSNEESMILEKMKRGRHSENENEENEEGEDRLSDLPDCIILHILSFLNTKHAVRT 62 >gb|AFK48553.1| unknown [Lotus japonicus] Length = 110 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 2/56 (3%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESEN--EENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNS DE ++ P KRGR +E E EEN+DRLSDLPDC+LL+IL F+ A++ V+T Sbjct: 1 MSNSTDEMLLQPNAKRGRRNEIETDIEENKDRLSDLPDCILLYILSFVKAKHVVQT 56 >ref|XP_003591875.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] gi|355480923|gb|AES62126.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] Length = 702 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSN ADE MI PK KR RHD E +N+DRLSDLPDC++LHIL FL++++ V+T Sbjct: 1 MSNLADEVMISPK-KRARHDNEE--KNQDRLSDLPDCLILHILSFLNSKHTVQT 51 >ref|XP_003617104.1| cytochrome C biogenesis protein ccsA [Medicago truncatula] gi|355518439|gb|AET00063.1| cytochrome C biogenesis protein ccsA [Medicago truncatula] Length = 402 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MS S DE +I P TKR + DESENE DRLSDLPDCV+LHIL FL+A+ AV T Sbjct: 1 MSYSVDEIIIQPATKRVKLDESENE---DRLSDLPDCVILHILSFLNAKQAVTT 51 >ref|XP_003608293.2| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] gi|657389490|gb|AES90490.2| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] Length = 827 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MS S DE MIPP KR R D NEEN+DRL+DLPDCV+LHIL FL +++ V+T Sbjct: 1 MSKSVDEVMIPPD-KRVRRD---NEENQDRLTDLPDCVILHILSFLKSKFVVQT 50 >ref|XP_003606067.2| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] gi|657387678|gb|AES88264.2| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] Length = 845 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MS S DE MIPP KR R D NEEN+DRL+DLPDCV+LHIL FL +++ V+T Sbjct: 1 MSKSVDEVMIPPD-KRVRRD---NEENQDRLTDLPDCVILHILSFLKSKFVVQT 50 >ref|XP_004504897.1| PREDICTED: F-box/LRR-repeat protein At1g55660-like isoform X2 [Cicer arietinum] Length = 428 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNS DE IPPK+KR +H ENED+LSDLPDCV+LHIL FL+A+ VRT Sbjct: 1 MSNS-DEITIPPKSKRLKH------ENEDKLSDLPDCVILHILSFLNAKEVVRT 47 >ref|XP_004504896.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Cicer arietinum] Length = 482 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNS DE IPPK+KR +H ENED+LSDLPDCV+LHIL FL+A+ VRT Sbjct: 1 MSNS-DEITIPPKSKRLKH------ENEDKLSDLPDCVILHILSFLNAKEVVRT 47 >ref|XP_004501663.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 [Cicer arietinum] Length = 406 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNSA E MIPP K+ + +E ENE DRLSDLPDC++LHIL F+ + AV+T Sbjct: 1 MSNSAYEIMIPPPAKKVKLNEIENE---DRLSDLPDCIILHILSFIKTKQAVQT 51 >ref|XP_003608306.2| F-box/RNI superfamily protein [Medicago truncatula] gi|657389496|gb|AES90503.2| F-box/RNI superfamily protein [Medicago truncatula] Length = 529 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +1 Query: 142 NSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 +S+ + I K K+ R E+ENEENED+LSDLP+CV+LHIL FL +++AV+T Sbjct: 6 DSSKKIRIQEKMKKIRQCETENEENEDKLSDLPECVILHILSFLDSKHAVQT 57 >ref|XP_013457158.1| F-box/RNI superfamily protein [Medicago truncatula] gi|657389495|gb|KEH31189.1| F-box/RNI superfamily protein [Medicago truncatula] Length = 440 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +1 Query: 142 NSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 +S+ + I K K+ R E+ENEENED+LSDLP+CV+LHIL FL +++AV+T Sbjct: 6 DSSKKIRIQEKMKKIRQCETENEENEDKLSDLPECVILHILSFLDSKHAVQT 57 >ref|XP_004504894.1| PREDICTED: FBD-associated F-box protein At1g60410-like [Cicer arietinum] Length = 481 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +1 Query: 160 MIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MIPP TKR RH NEENED+ SDLPDCVL+HIL FL+ + AV T Sbjct: 2 MIPPMTKRTRHC---NEENEDKFSDLPDCVLIHILSFLNTKNAVGT 44 >ref|XP_003629672.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] gi|355523694|gb|AET04148.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula] Length = 709 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNS DE MIPP K R D N+EN DR+SDLPDC+LLHIL L ++ V+T Sbjct: 1 MSNSVDEVMIPPN-KIARRD---NDENHDRISDLPDCILLHILSLLHSKQVVQT 50 >ref|XP_013459827.1| F-box/RNI/FBD-like domain protein, putative [Medicago truncatula] gi|657392982|gb|KEH33858.1| F-box/RNI/FBD-like domain protein, putative [Medicago truncatula] Length = 472 Score = 59.7 bits (143), Expect = 8e-07 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNSADE IPP+ + SE E NEDRLSDLP+ V+LHIL FL+ ++AV+T Sbjct: 1 MSNSADEITIPPQLTKKVKLSSECE-NEDRLSDLPESVILHILSFLNTKHAVQT 53 >ref|XP_013459826.1| F-box/RNI/FBD-like domain protein, putative [Medicago truncatula] gi|657392981|gb|KEH33857.1| F-box/RNI/FBD-like domain protein, putative [Medicago truncatula] Length = 482 Score = 59.7 bits (143), Expect = 8e-07 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNSADE IPP+ + SE E NEDRLSDLP+ V+LHIL FL+ ++AV+T Sbjct: 1 MSNSADEITIPPQLTKKVKLSSECE-NEDRLSDLPESVILHILSFLNTKHAVQT 53 >ref|XP_013459825.1| F-box/RNI/FBD-like domain protein, putative [Medicago truncatula] gi|657392980|gb|KEH33856.1| F-box/RNI/FBD-like domain protein, putative [Medicago truncatula] Length = 459 Score = 59.7 bits (143), Expect = 8e-07 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNSADE IPP+ + SE E NEDRLSDLP+ V+LHIL FL+ ++AV+T Sbjct: 1 MSNSADEITIPPQLTKKVKLSSECE-NEDRLSDLPESVILHILSFLNTKHAVQT 53 >ref|XP_013457156.1| F-box/RNI superfamily protein [Medicago truncatula] gi|657389489|gb|KEH31187.1| F-box/RNI superfamily protein [Medicago truncatula] Length = 396 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +1 Query: 136 MSNSA--DETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNSA D+ MIP K ++ + + NEE D LSDLPDCV+LHIL FL+A+ AVRT Sbjct: 1 MSNSAVEDDLMIPSKLRKTKKLKQGNEE--DNLSDLPDCVILHILSFLNAKEAVRT 54 >ref|XP_003606020.1| F-box/RNI superfamily protein [Medicago truncatula] gi|355507075|gb|AES88217.1| F-box/RNI superfamily protein [Medicago truncatula] Length = 489 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +1 Query: 136 MSNSA--DETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNSA D+ MIP K ++ + + NEE D LSDLPDCV+LHIL FL+A+ AVRT Sbjct: 1 MSNSAVEDDLMIPSKLRKTKKLKQGNEE--DNLSDLPDCVILHILSFLNAKEAVRT 54 >ref|XP_004501665.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like [Cicer arietinum] gi|828313425|ref|XP_012571605.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like [Cicer arietinum] Length = 412 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +1 Query: 136 MSNSADE-TMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNS+D TMI P TKR E +N++N +SDLPDC++LHIL FL+A+ AVRT Sbjct: 1 MSNSSDAVTMIEPTTKRVTIRECQNKDN---ISDLPDCIILHILSFLNAKDAVRT 52 >ref|XP_013459831.1| F-box protein, putative [Medicago truncatula] gi|657392986|gb|KEH33862.1| F-box protein, putative [Medicago truncatula] Length = 464 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +1 Query: 136 MSNSADETMIPPKTKRGRHDESENEENEDRLSDLPDCVLLHILGFLSARYAVRT 297 MSNS DE MIPP + SE E NEDRLSDLP+ V+LHIL FL+ + AV+T Sbjct: 1 MSNSEDEIMIPPPPTKKVKLSSECE-NEDRLSDLPESVILHILSFLNTKDAVQT 53