BLASTX nr result
ID: Wisteria21_contig00018670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00018670 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241545.1| uncharacterized protein LOC100791789 [Glycin... 79 2e-12 ref|XP_007134466.1| hypothetical protein PHAVU_010G049700g [Phas... 74 6e-11 ref|XP_013443829.1| RING finger protein [Medicago truncatula] gi... 73 7e-11 ref|XP_004515347.1| PREDICTED: uncharacterized protein LOC101515... 70 6e-10 ref|XP_014515055.1| PREDICTED: uncharacterized protein LOC106772... 70 8e-10 gb|KOM58626.1| hypothetical protein LR48_Vigan11g166000 [Vigna a... 70 8e-10 ref|XP_002302496.1| RWD domain-containing family protein [Populu... 64 4e-08 ref|XP_002511580.1| RING finger protein, putative [Ricinus commu... 63 7e-08 ref|XP_006445436.1| hypothetical protein CICLE_v10020918mg [Citr... 63 1e-07 ref|XP_006445435.1| hypothetical protein CICLE_v10020918mg [Citr... 63 1e-07 ref|XP_007052322.1| RWD domain-containing protein, putative isof... 63 1e-07 ref|XP_008232489.1| PREDICTED: E3 ubiquitin-protein ligase RNF25... 62 1e-07 ref|XP_007218162.1| hypothetical protein PRUPE_ppa007473mg [Prun... 62 1e-07 ref|XP_002876546.1| predicted protein [Arabidopsis lyrata subsp.... 62 2e-07 ref|XP_010413575.1| PREDICTED: E3 ubiquitin-protein ligase RNF25... 61 3e-07 ref|XP_010413574.1| PREDICTED: E3 ubiquitin-protein ligase RNF25... 61 3e-07 ref|XP_010512343.1| PREDICTED: E3 ubiquitin-protein ligase RNF25... 61 3e-07 ref|XP_010512342.1| PREDICTED: E3 ubiquitin-protein ligase RNF25... 61 3e-07 ref|XP_004306985.1| PREDICTED: uncharacterized protein LOC101314... 61 3e-07 gb|KNA11743.1| hypothetical protein SOVF_132340 [Spinacia oleracea] 61 4e-07 >ref|NP_001241545.1| uncharacterized protein LOC100791789 [Glycine max] gi|255644864|gb|ACU22932.1| unknown [Glycine max] gi|734311811|gb|KHN00201.1| E3 ubiquitin-protein ligase RNF25 [Glycine soja] gi|947118256|gb|KRH66505.1| hypothetical protein GLYMA_03G110700 [Glycine max] Length = 366 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 YGTDCVLLRS PPHFHISLKPRTADVSS+QFVE +LE++AS Sbjct: 21 YGTDCVLLRSFPPHFHISLKPRTADVSSQQFVEAVLEIQAS 61 >ref|XP_007134466.1| hypothetical protein PHAVU_010G049700g [Phaseolus vulgaris] gi|561007511|gb|ESW06460.1| hypothetical protein PHAVU_010G049700g [Phaseolus vulgaris] Length = 363 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 YGTDCVLL S PPHFH+ LKPRTADVSS+QFVE +LE+RA+ Sbjct: 21 YGTDCVLLSSFPPHFHLFLKPRTADVSSQQFVEAVLEIRAT 61 >ref|XP_013443829.1| RING finger protein [Medicago truncatula] gi|657371902|gb|KEH17854.1| RING finger protein [Medicago truncatula] Length = 364 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/41 (75%), Positives = 39/41 (95%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 Y TDCV+LRS+PPHFH+SLKPRTADVS +QFVE++LEV+A+ Sbjct: 21 YETDCVILRSIPPHFHLSLKPRTADVSYDQFVEIVLEVKAT 61 >ref|XP_004515347.1| PREDICTED: uncharacterized protein LOC101515324 [Cicer arietinum] Length = 360 Score = 70.1 bits (170), Expect = 6e-10 Identities = 29/41 (70%), Positives = 38/41 (92%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 Y +DC++LRS+PPHFH+SLKPRTADV S QFVEV+L+V+A+ Sbjct: 20 YESDCIILRSIPPHFHLSLKPRTADVQSHQFVEVVLDVQAT 60 >ref|XP_014515055.1| PREDICTED: uncharacterized protein LOC106772928 [Vigna radiata var. radiata] Length = 362 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 YGTDC +L S PPHFH+ LKPRTADVSS+QFVE +LE++A+ Sbjct: 20 YGTDCTVLSSFPPHFHLFLKPRTADVSSQQFVEAVLEIKAT 60 >gb|KOM58626.1| hypothetical protein LR48_Vigan11g166000 [Vigna angularis] Length = 362 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 YGTDC +L S PPHFH+ LKPRTADVSS+QFVE +LE++A+ Sbjct: 20 YGTDCTVLSSFPPHFHLFLKPRTADVSSQQFVEAVLEIKAT 60 >ref|XP_002302496.1| RWD domain-containing family protein [Populus trichocarpa] gi|222844222|gb|EEE81769.1| RWD domain-containing family protein [Populus trichocarpa] Length = 354 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTAD+SS+QFVE ++ +RA Sbjct: 17 YGDDCVILESFPPHLHLHIKPRTADISSQQFVEAVIGIRA 56 >ref|XP_002511580.1| RING finger protein, putative [Ricinus communis] gi|223548760|gb|EEF50249.1| RING finger protein, putative [Ricinus communis] Length = 355 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV++ S PPH H+ +KPRTADVSS+QFVE I+ +RA Sbjct: 21 YGDDCVVIDSFPPHLHVHIKPRTADVSSQQFVEAIIGIRA 60 >ref|XP_006445436.1| hypothetical protein CICLE_v10020918mg [Citrus clementina] gi|568819767|ref|XP_006464417.1| PREDICTED: uncharacterized protein LOC102625474 [Citrus sinensis] gi|557547698|gb|ESR58676.1| hypothetical protein CICLE_v10020918mg [Citrus clementina] gi|641866816|gb|KDO85500.1| hypothetical protein CISIN_1g018975mg [Citrus sinensis] Length = 348 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 YG +CV+L S PPH H+ +KPRTADVSS+QFVE ++ +RAS Sbjct: 17 YGDECVVLDSYPPHLHLRIKPRTADVSSQQFVEAVIGIRAS 57 >ref|XP_006445435.1| hypothetical protein CICLE_v10020918mg [Citrus clementina] gi|557547697|gb|ESR58675.1| hypothetical protein CICLE_v10020918mg [Citrus clementina] Length = 320 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRAS 256 YG +CV+L S PPH H+ +KPRTADVSS+QFVE ++ +RAS Sbjct: 17 YGDECVVLDSYPPHLHLRIKPRTADVSSQQFVEAVIGIRAS 57 >ref|XP_007052322.1| RWD domain-containing protein, putative isoform 1 [Theobroma cacao] gi|508704583|gb|EOX96479.1| RWD domain-containing protein, putative isoform 1 [Theobroma cacao] Length = 350 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV++ S PPH H+ +KPRTADVSS+QFVE I+ +RA Sbjct: 18 YGEDCVVVESYPPHLHLHIKPRTADVSSQQFVEAIIGIRA 57 >ref|XP_008232489.1| PREDICTED: E3 ubiquitin-protein ligase RNF25 [Prunus mume] Length = 359 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTADV+S+QFVE ++ VRA Sbjct: 22 YGDDCVVLESYPPHLHLYIKPRTADVASQQFVEAVIGVRA 61 >ref|XP_007218162.1| hypothetical protein PRUPE_ppa007473mg [Prunus persica] gi|462414624|gb|EMJ19361.1| hypothetical protein PRUPE_ppa007473mg [Prunus persica] Length = 366 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTADV+S+QFVE ++ VRA Sbjct: 22 YGDDCVVLESYPPHLHLYIKPRTADVASQQFVEAVIGVRA 61 >ref|XP_002876546.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322384|gb|EFH52805.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 335 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTAD+SS+QFVE ++ ++A Sbjct: 17 YGEDCVILDSYPPHLHLHIKPRTADISSQQFVEAVVRIQA 56 >ref|XP_010413575.1| PREDICTED: E3 ubiquitin-protein ligase RNF25-like isoform X2 [Camelina sativa] Length = 236 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTA++SS+QFVE +L ++A Sbjct: 17 YGEDCVILDSYPPHLHLHMKPRTAEISSQQFVEAVLRIQA 56 >ref|XP_010413574.1| PREDICTED: E3 ubiquitin-protein ligase RNF25-like isoform X1 [Camelina sativa] Length = 362 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTA++SS+QFVE +L ++A Sbjct: 17 YGEDCVILDSYPPHLHLHMKPRTAEISSQQFVEAVLRIQA 56 >ref|XP_010512343.1| PREDICTED: E3 ubiquitin-protein ligase RNF25-like isoform X2 [Camelina sativa] Length = 366 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTA++SS+QFVE +L ++A Sbjct: 17 YGEDCVILDSYPPHLHLHMKPRTAEISSQQFVEAVLRIQA 56 >ref|XP_010512342.1| PREDICTED: E3 ubiquitin-protein ligase RNF25-like isoform X1 [Camelina sativa] Length = 371 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PPH H+ +KPRTA++SS+QFVE +L ++A Sbjct: 17 YGEDCVILDSYPPHLHLHMKPRTAEISSQQFVEAVLRIQA 56 >ref|XP_004306985.1| PREDICTED: uncharacterized protein LOC101314503 [Fragaria vesca subsp. vesca] Length = 356 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DCV+L S PP H+ +KPRTADV+S+QFVE ++E+RA Sbjct: 19 YGDDCVVLDSYPPRIHLHIKPRTADVASQQFVEAVIEIRA 58 >gb|KNA11743.1| hypothetical protein SOVF_132340 [Spinacia oleracea] Length = 373 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 134 YGTDCVLLRSLPPHFHISLKPRTADVSSEQFVEVILEVRA 253 YG DC++L PPH H+ +KPRTADV S+QFVE +E+RA Sbjct: 18 YGDDCIILNRFPPHLHLHIKPRTADVDSQQFVEATIELRA 57