BLASTX nr result
ID: Wisteria21_contig00018460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00018460 (1161 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006587995.1| PREDICTED: extensin-2-like [Glycine max] gi|... 59 8e-06 >ref|XP_006587995.1| PREDICTED: extensin-2-like [Glycine max] gi|947088367|gb|KRH37032.1| hypothetical protein GLYMA_09G039800 [Glycine max] Length = 165 Score = 58.9 bits (141), Expect = 8e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 959 VCCCFMIVLLSLTVIAVGLADQNLKTTSKEGDVKCTPCGQV 837 V CCFM+ LSL +A+ L D NLKTTS++ D+KCTPCGQV Sbjct: 5 VWCCFMMFFLSLNALAIALEDHNLKTTSRD-DIKCTPCGQV 44