BLASTX nr result
ID: Wisteria21_contig00018254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00018254 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN15725.1| Dymeclin [Glycine soja] 62 2e-07 ref|XP_006606079.1| PREDICTED: dymeclin-like isoform X2 [Glycine... 62 2e-07 ref|XP_003556068.1| PREDICTED: dymeclin-like isoform X1 [Glycine... 62 2e-07 gb|KRH35451.1| hypothetical protein GLYMA_10G243900 [Glycine max] 60 8e-07 gb|KHN02752.1| Dymeclin [Glycine soja] 60 8e-07 ref|XP_006589578.1| PREDICTED: dymeclin-like isoform X2 [Glycine... 60 8e-07 ref|XP_003536505.1| PREDICTED: dymeclin-like isoformX1 [Glycine ... 60 8e-07 ref|XP_007143315.1| hypothetical protein PHAVU_007G061900g [Phas... 59 1e-06 ref|XP_004496672.1| PREDICTED: dymeclin [Cicer arietinum] 59 2e-06 >gb|KHN15725.1| Dymeclin [Glycine soja] Length = 723 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGSVPSTPR+GGA+SPETAEYL+GTFVGD P Sbjct: 1 MGSVPSTPRRGGAYSPETAEYLIGTFVGDTP 31 >ref|XP_006606079.1| PREDICTED: dymeclin-like isoform X2 [Glycine max] gi|947041646|gb|KRG91370.1| hypothetical protein GLYMA_20G150500 [Glycine max] Length = 643 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGSVPSTPR+GGA+SPETAEYL+GTFVGD P Sbjct: 1 MGSVPSTPRRGGAYSPETAEYLIGTFVGDTP 31 >ref|XP_003556068.1| PREDICTED: dymeclin-like isoform X1 [Glycine max] gi|947041645|gb|KRG91369.1| hypothetical protein GLYMA_20G150500 [Glycine max] Length = 723 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGSVPSTPR+GGA+SPETAEYL+GTFVGD P Sbjct: 1 MGSVPSTPRRGGAYSPETAEYLIGTFVGDTP 31 >gb|KRH35451.1| hypothetical protein GLYMA_10G243900 [Glycine max] Length = 700 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGS PSTPR+GGAFSPE AEYL+GTFVGD P Sbjct: 1 MGSAPSTPRRGGAFSPEAAEYLIGTFVGDTP 31 >gb|KHN02752.1| Dymeclin [Glycine soja] Length = 722 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGS PSTPR+GGAFSPE AEYL+GTFVGD P Sbjct: 1 MGSAPSTPRRGGAFSPEAAEYLIGTFVGDTP 31 >ref|XP_006589578.1| PREDICTED: dymeclin-like isoform X2 [Glycine max] Length = 642 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGS PSTPR+GGAFSPE AEYL+GTFVGD P Sbjct: 1 MGSAPSTPRRGGAFSPEAAEYLIGTFVGDTP 31 >ref|XP_003536505.1| PREDICTED: dymeclin-like isoformX1 [Glycine max] gi|947086729|gb|KRH35450.1| hypothetical protein GLYMA_10G243900 [Glycine max] Length = 722 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGS PSTPR+GGAFSPE AEYL+GTFVGD P Sbjct: 1 MGSAPSTPRRGGAFSPEAAEYLIGTFVGDTP 31 >ref|XP_007143315.1| hypothetical protein PHAVU_007G061900g [Phaseolus vulgaris] gi|561016505|gb|ESW15309.1| hypothetical protein PHAVU_007G061900g [Phaseolus vulgaris] Length = 722 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDEP 3 MGSVPSTPRK G FSPETAEYL+GTFV D+P Sbjct: 1 MGSVPSTPRKSGTFSPETAEYLIGTFVDDQP 31 >ref|XP_004496672.1| PREDICTED: dymeclin [Cicer arietinum] Length = 722 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 95 MGSVPSTPRKGGAFSPETAEYLMGTFVGDE 6 MGSVPSTPRKGG FSP+TAEYL+GTFVG E Sbjct: 1 MGSVPSTPRKGGEFSPDTAEYLIGTFVGSE 30