BLASTX nr result
ID: Wisteria21_contig00018161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00018161 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH15349.1| hypothetical protein GLYMA_14G082300 [Glycine max] 41 8e-06 >gb|KRH15349.1| hypothetical protein GLYMA_14G082300 [Glycine max] Length = 368 Score = 41.2 bits (95), Expect(2) = 8e-06 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Frame = +2 Query: 170 LVSLQDNLNTVMETH-QHQKSRENDVEKQSEAAAK-------QXXXXXXXXXHEFSFTIS 325 LV LQ NL TVMETH QHQK+ ENDV KQ + Q EFSFTIS Sbjct: 59 LVILQGNL-TVMETHHQHQKNTENDVPKQQNQIEEAVNRELDQTSSSPSSPSQEFSFTIS 117 Score = 35.0 bits (79), Expect(2) = 8e-06 Identities = 22/47 (46%), Positives = 25/47 (53%) Frame = +1 Query: 28 VPLSLLKSFVNIHXXXXXXXXXXPFYLSPPKRKHYRPRISDTASNLV 168 +PLS K +IH F L+ KRK Y PRISD ASNLV Sbjct: 18 IPLSPSKGLFDIHTRNITKL----FPLAITKRKDYTPRISDIASNLV 60