BLASTX nr result
ID: Wisteria21_contig00017608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00017608 (220 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN25451.1| Auxin-induced protein 15A [Glycine soja] 106 6e-21 ref|XP_003607114.1| SAUR-like auxin-responsive family protein [M... 105 1e-20 ref|XP_004507000.1| PREDICTED: auxin-induced protein X10A-like [... 103 5e-20 ref|XP_007131734.1| hypothetical protein PHAVU_011G037400g [Phas... 102 8e-20 ref|XP_003533487.1| PREDICTED: auxin-induced protein X10A-like [... 102 1e-19 ref|XP_003607134.2| SAUR-like auxin-responsive family protein [M... 100 3e-19 ref|XP_007131733.1| hypothetical protein PHAVU_011G037300g [Phas... 100 3e-19 ref|XP_004506998.1| PREDICTED: auxin-induced protein 15A-like [C... 100 3e-19 ref|XP_003607109.1| SAUR-like auxin-responsive family protein [M... 100 3e-19 ref|XP_007131732.1| hypothetical protein PHAVU_011G037200g [Phas... 100 4e-19 ref|XP_003607131.1| SAUR-like auxin-responsive family protein [M... 100 4e-19 ref|XP_007131728.1| hypothetical protein PHAVU_011G036800g [Phas... 100 7e-19 ref|XP_004506994.1| PREDICTED: auxin-induced protein 15A-like [C... 100 7e-19 gb|KHN11775.1| Auxin-induced protein 6B [Glycine soja] gi|947091... 99 1e-18 ref|XP_003607140.2| SAUR-like auxin-responsive family protein [M... 99 1e-18 ref|XP_003607138.1| SAUR-like auxin-responsive family protein [M... 99 1e-18 ref|XP_003607122.1| SAUR-like auxin-responsive family protein [M... 99 1e-18 gb|KOM34033.1| hypothetical protein LR48_Vigan02g018300 [Vigna a... 99 2e-18 emb|CDP18416.1| unnamed protein product [Coffea canephora] 99 2e-18 ref|XP_003540661.1| PREDICTED: auxin-induced protein 6B-like [Gl... 99 2e-18 >gb|KHN25451.1| Auxin-induced protein 15A [Glycine soja] Length = 86 Score = 106 bits (265), Expect = 6e-21 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIP+SYL Q SFQDLLSQAEE+FGYDHPMGGLTIPCREDVFLD TSRLNRC Sbjct: 33 KRFVIPLSYLNQRSFQDLLSQAEEEFGYDHPMGGLTIPCREDVFLDTTSRLNRC 86 >ref|XP_003607114.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|355508169|gb|AES89311.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 90 Score = 105 bits (262), Expect = 1e-20 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIPISYL Q+SFQ+LL+QAEEQFGYDHPMGGLTIPCREDVFLDITSRLN C Sbjct: 37 KRFVIPISYLSQSSFQELLNQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNLC 90 >ref|XP_004507000.1| PREDICTED: auxin-induced protein X10A-like [Cicer arietinum] Length = 90 Score = 103 bits (257), Expect = 5e-20 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIP+SYL QTSFQ+LLSQAEEQFGYDHP GGL IPCREDVFLDITSRLN C Sbjct: 37 KRFVIPVSYLNQTSFQELLSQAEEQFGYDHPTGGLMIPCREDVFLDITSRLNLC 90 >ref|XP_007131734.1| hypothetical protein PHAVU_011G037400g [Phaseolus vulgaris] gi|561004734|gb|ESW03728.1| hypothetical protein PHAVU_011G037400g [Phaseolus vulgaris] Length = 92 Score = 102 bits (255), Expect = 8e-20 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIP+SYL Q SFQDLLSQ EE+FGY HPMGGLTIPCREDVFLD TSRLNRC Sbjct: 39 KRFVIPVSYLNQPSFQDLLSQVEEEFGYHHPMGGLTIPCREDVFLDTTSRLNRC 92 >ref|XP_003533487.1| PREDICTED: auxin-induced protein X10A-like [Glycine max] gi|734348187|gb|KHN11765.1| Auxin-induced protein X10A [Glycine soja] gi|947091137|gb|KRH39802.1| hypothetical protein GLYMA_09G220900 [Glycine max] Length = 92 Score = 102 bits (253), Expect = 1e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 K+FVIP+SYL Q SFQDLLS+AEE+FGYDHPMGGLTIPCREDVFLD +SRLNRC Sbjct: 39 KQFVIPLSYLNQPSFQDLLSKAEEEFGYDHPMGGLTIPCREDVFLDTSSRLNRC 92 >ref|XP_003607134.2| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|657388570|gb|AES89331.2| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 86 Score = 100 bits (250), Expect = 3e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIP+SYL QTSFQDLLSQA E+FGYDHPMGGLTIPC ED F+DITSRL+RC Sbjct: 33 KRFVIPMSYLNQTSFQDLLSQAVEEFGYDHPMGGLTIPCEEDFFVDITSRLSRC 86 >ref|XP_007131733.1| hypothetical protein PHAVU_011G037300g [Phaseolus vulgaris] gi|561004733|gb|ESW03727.1| hypothetical protein PHAVU_011G037300g [Phaseolus vulgaris] Length = 92 Score = 100 bits (250), Expect = 3e-19 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRF IP+SYL Q SFQDLLSQAEE+FGY+HPMGGLTIPCREDVFLD TS LNRC Sbjct: 39 KRFFIPVSYLNQPSFQDLLSQAEEEFGYNHPMGGLTIPCREDVFLDTTSSLNRC 92 >ref|XP_004506998.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum] Length = 87 Score = 100 bits (250), Expect = 3e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIPI+YL Q SFQ+LL QAEEQF YDHPMGGLTIPCREDVFLDITSRL+RC Sbjct: 34 KRFVIPIAYLNQPSFQELLHQAEEQFEYDHPMGGLTIPCREDVFLDITSRLSRC 87 >ref|XP_003607109.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|355508164|gb|AES89306.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 90 Score = 100 bits (250), Expect = 3e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIPISYL Q SFQ+LL+QAEEQFGYDHP GGLTIPCREDVFL+ITSRLN C Sbjct: 37 KRFVIPISYLNQPSFQELLNQAEEQFGYDHPTGGLTIPCREDVFLNITSRLNLC 90 >ref|XP_007131732.1| hypothetical protein PHAVU_011G037200g [Phaseolus vulgaris] gi|561004732|gb|ESW03726.1| hypothetical protein PHAVU_011G037200g [Phaseolus vulgaris] Length = 92 Score = 100 bits (249), Expect = 4e-19 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRF+IP+SYL Q SFQDLLSQAEE+FGYDHPMGGLTIPC EDVF+DITSR +RC Sbjct: 39 KRFMIPVSYLNQPSFQDLLSQAEEEFGYDHPMGGLTIPCGEDVFVDITSRFHRC 92 >ref|XP_003607131.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|355508186|gb|AES89328.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 87 Score = 100 bits (249), Expect = 4e-19 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIPISYL Q SFQDLL+QAEEQF YDHPMGGLTIPC ED+FLDITSRL+RC Sbjct: 34 KRFVIPISYLNQPSFQDLLNQAEEQFEYDHPMGGLTIPCGEDMFLDITSRLSRC 87 >ref|XP_007131728.1| hypothetical protein PHAVU_011G036800g [Phaseolus vulgaris] gi|561004728|gb|ESW03722.1| hypothetical protein PHAVU_011G036800g [Phaseolus vulgaris] Length = 92 Score = 99.8 bits (247), Expect = 7e-19 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRF+IP+SYL Q SFQDLLSQAE++FGYDHPMGGLTIPCREDVFLD S LNRC Sbjct: 39 KRFMIPVSYLNQPSFQDLLSQAEKEFGYDHPMGGLTIPCREDVFLDTISSLNRC 92 >ref|XP_004506994.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum] Length = 85 Score = 99.8 bits (247), Expect = 7e-19 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLN 64 KRFVIPISYL Q FQ+LLSQ EEQFGYDHPMGGLTIPCREDVFLDITSRLN Sbjct: 34 KRFVIPISYLNQPLFQELLSQVEEQFGYDHPMGGLTIPCREDVFLDITSRLN 85 >gb|KHN11775.1| Auxin-induced protein 6B [Glycine soja] gi|947091126|gb|KRH39791.1| hypothetical protein GLYMA_09G219800 [Glycine max] Length = 91 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/55 (87%), Positives = 51/55 (92%), Gaps = 1/55 (1%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRL-NRC 58 KRFVIP+SYL+QTSFQDLLS AEE+FGY HPMGGLTIPC EDVFLDITSRL NRC Sbjct: 37 KRFVIPLSYLKQTSFQDLLSLAEEEFGYKHPMGGLTIPCGEDVFLDITSRLNNRC 91 >ref|XP_003607140.2| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|657388571|gb|AES89337.2| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 86 Score = 99.0 bits (245), Expect = 1e-18 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLN 64 KRFVIPISYL QTSFQ+LL+QAEEQ+ YDHPMGGLTIPCRE+VFLDITSRLN Sbjct: 35 KRFVIPISYLNQTSFQELLNQAEEQYEYDHPMGGLTIPCREEVFLDITSRLN 86 >ref|XP_003607138.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|355508193|gb|AES89335.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 86 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIP+SYL QTS Q+LLSQA E+FGYDHPMGGLTIPC ED+FLDITSRL+RC Sbjct: 33 KRFVIPMSYLNQTSLQELLSQAVEEFGYDHPMGGLTIPCEEDLFLDITSRLSRC 86 >ref|XP_003607122.1| SAUR-like auxin-responsive family protein [Medicago truncatula] gi|355508177|gb|AES89319.1| SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 85 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLN 64 KRFVIP+SYL QTSFQ+LLSQ+EEQF YDHPMGGLTIPCRED+FLDITS LN Sbjct: 34 KRFVIPVSYLNQTSFQELLSQSEEQFEYDHPMGGLTIPCREDIFLDITSHLN 85 >gb|KOM34033.1| hypothetical protein LR48_Vigan02g018300 [Vigna angularis] gi|920708968|gb|KOM50965.1| hypothetical protein LR48_Vigan08g179200 [Vigna angularis] Length = 92 Score = 98.6 bits (244), Expect = 2e-18 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRF+IP+SYL Q FQDLLSQ EE FGY+HPMGGLTIPCREDVFLDITSRL RC Sbjct: 39 KRFMIPVSYLNQPLFQDLLSQTEEDFGYEHPMGGLTIPCREDVFLDITSRLMRC 92 >emb|CDP18416.1| unnamed protein product [Coffea canephora] Length = 102 Score = 98.6 bits (244), Expect = 2e-18 Identities = 41/54 (75%), Positives = 53/54 (98%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLNRC 58 KRFVIP++YL +++FQ+LLSQAEE+FG+DHPMGGLTIPCRED+F+D+TSRL+RC Sbjct: 47 KRFVIPVAYLNESAFQELLSQAEEEFGFDHPMGGLTIPCREDMFIDLTSRLSRC 100 >ref|XP_003540661.1| PREDICTED: auxin-induced protein 6B-like [Glycine max] gi|947075505|gb|KRH24345.1| hypothetical protein GLYMA_12G035300 [Glycine max] Length = 92 Score = 98.6 bits (244), Expect = 2e-18 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -2 Query: 219 KRFVIPISYLRQTSFQDLLSQAEEQFGYDHPMGGLTIPCREDVFLDITSRLN 64 KRFVIPISYL Q+SFQDLLS+AEE+FGYDHPMGGLTIPCREDVF +ITSRLN Sbjct: 39 KRFVIPISYLTQSSFQDLLSRAEEEFGYDHPMGGLTIPCREDVFQNITSRLN 90