BLASTX nr result
ID: Wisteria21_contig00017536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00017536 (412 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004491091.1| PREDICTED: zinc finger CCCH domain-containin... 94 5e-17 ref|XP_014505309.1| PREDICTED: zinc finger CCCH domain-containin... 92 2e-16 ref|XP_007141660.1| hypothetical protein PHAVU_008G214600g [Phas... 89 1e-15 ref|XP_003616871.1| zinc finger CCCH domain protein [Medicago tr... 88 2e-15 ref|XP_014505308.1| PREDICTED: zinc finger CCCH domain-containin... 86 1e-14 ref|XP_007141661.1| hypothetical protein PHAVU_008G214600g [Phas... 83 9e-14 ref|XP_003519444.1| PREDICTED: zinc finger CCCH domain-containin... 81 4e-13 gb|KRH14806.1| hypothetical protein GLYMA_14G050000 [Glycine max... 80 5e-13 gb|KHN44751.1| Zinc finger CCCH domain-containing protein 3 [Gly... 80 5e-13 ref|XP_003545603.1| PREDICTED: zinc finger CCCH domain-containin... 80 5e-13 gb|KHN38500.1| Zinc finger CCCH domain-containing protein 3 [Gly... 74 3e-11 gb|KRH14808.1| hypothetical protein GLYMA_14G050000 [Glycine max] 74 4e-11 ref|XP_006595836.1| PREDICTED: zinc finger CCCH domain-containin... 74 4e-11 ref|XP_008229811.1| PREDICTED: zinc finger CCCH domain-containin... 69 2e-09 ref|XP_007049198.1| Zinc finger C-x8-C-x5-C-x3-H type family pro... 69 2e-09 ref|XP_007049197.1| Zinc finger C-x8-C-x5-C-x3-H type family pro... 69 2e-09 gb|KDO59558.1| hypothetical protein CISIN_1g013033mg [Citrus sin... 67 7e-09 gb|KDO59557.1| hypothetical protein CISIN_1g013033mg [Citrus sin... 67 7e-09 ref|XP_006447662.1| hypothetical protein CICLE_v10015215mg [Citr... 67 7e-09 ref|XP_012472851.1| PREDICTED: zinc finger CCCH domain-containin... 66 1e-08 >ref|XP_004491091.1| PREDICTED: zinc finger CCCH domain-containing protein 3 [Cicer arietinum] Length = 422 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVL+NAASNPSGDNIE+AIRRLKINDNRDRD AQS P+PDRPG Sbjct: 1 MPENRQVLKNAASNPSGDNIEDAIRRLKINDNRDRDVTAQSLPFPDRPG 49 >ref|XP_014505309.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like isoform X2 [Vigna radiata var. radiata] Length = 419 Score = 92.0 bits (227), Expect = 2e-16 Identities = 45/49 (91%), Positives = 45/49 (91%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S PSGDNIEEAIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSTPSGDNIEEAIRRLKINDNWDRDAAAQSTQYPDRPG 49 >ref|XP_007141660.1| hypothetical protein PHAVU_008G214600g [Phaseolus vulgaris] gi|561014793|gb|ESW13654.1| hypothetical protein PHAVU_008G214600g [Phaseolus vulgaris] Length = 421 Score = 89.4 bits (220), Expect = 1e-15 Identities = 44/49 (89%), Positives = 44/49 (89%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQV RNA S PSGDNIEEAIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVHRNADSTPSGDNIEEAIRRLKINDNWDRDAAAQSTQYPDRPG 49 >ref|XP_003616871.1| zinc finger CCCH domain protein [Medicago truncatula] gi|355518206|gb|AES99829.1| zinc finger CCCH domain protein [Medicago truncatula] Length = 422 Score = 88.2 bits (217), Expect = 2e-15 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQV +NA SNPSGDNIEEAIRRLKIN RDRDA QS PYPDRPG Sbjct: 1 MPENRQVFKNAGSNPSGDNIEEAIRRLKINSTRDRDAVPQSMPYPDRPG 49 >ref|XP_014505308.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like isoform X1 [Vigna radiata var. radiata] Length = 425 Score = 85.5 bits (210), Expect = 1e-14 Identities = 45/55 (81%), Positives = 45/55 (81%), Gaps = 6/55 (10%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIE------EAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S PSGDNIE EAIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSTPSGDNIEGGADFSEAIRRLKINDNWDRDAAAQSTQYPDRPG 55 >ref|XP_007141661.1| hypothetical protein PHAVU_008G214600g [Phaseolus vulgaris] gi|561014794|gb|ESW13655.1| hypothetical protein PHAVU_008G214600g [Phaseolus vulgaris] Length = 420 Score = 82.8 bits (203), Expect = 9e-14 Identities = 43/49 (87%), Positives = 43/49 (87%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQV RNA S PSGDNIE AIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVHRNADSTPSGDNIE-AIRRLKINDNWDRDAAAQSTQYPDRPG 48 >ref|XP_003519444.1| PREDICTED: zinc finger CCCH domain-containing protein 3 isoformX1 [Glycine max] gi|947125127|gb|KRH73333.1| hypothetical protein GLYMA_02G267500 [Glycine max] gi|947125128|gb|KRH73334.1| hypothetical protein GLYMA_02G267500 [Glycine max] Length = 415 Score = 80.9 bits (198), Expect = 4e-13 Identities = 42/49 (85%), Positives = 42/49 (85%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA SGDNIEEAIR LKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNA---DSGDNIEEAIRHLKINDNWDRDAAAQSTQYPDRPG 46 >gb|KRH14806.1| hypothetical protein GLYMA_14G050000 [Glycine max] gi|947065664|gb|KRH14807.1| hypothetical protein GLYMA_14G050000 [Glycine max] Length = 417 Score = 80.5 bits (197), Expect = 5e-13 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S+ DNIEEAIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSS---DNIEEAIRRLKINDNWDRDAAAQSTQYPDRPG 46 >gb|KHN44751.1| Zinc finger CCCH domain-containing protein 3 [Glycine soja] Length = 417 Score = 80.5 bits (197), Expect = 5e-13 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S+ DNIEEAIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSS---DNIEEAIRRLKINDNWDRDAAAQSTQYPDRPG 46 >ref|XP_003545603.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like isoform X1 [Glycine max] gi|571507280|ref|XP_006595835.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like isoform X2 [Glycine max] Length = 417 Score = 80.5 bits (197), Expect = 5e-13 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S+ DNIEEAIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSS---DNIEEAIRRLKINDNWDRDAAAQSTQYPDRPG 46 >gb|KHN38500.1| Zinc finger CCCH domain-containing protein 3 [Glycine soja] gi|947125129|gb|KRH73335.1| hypothetical protein GLYMA_02G267500 [Glycine max] gi|947125130|gb|KRH73336.1| hypothetical protein GLYMA_02G267500 [Glycine max] Length = 421 Score = 74.3 bits (181), Expect = 3e-11 Identities = 42/55 (76%), Positives = 42/55 (76%), Gaps = 6/55 (10%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIE------EAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA SGDNIE EAIR LKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNA---DSGDNIEGGADFSEAIRHLKINDNWDRDAAAQSTQYPDRPG 52 >gb|KRH14808.1| hypothetical protein GLYMA_14G050000 [Glycine max] Length = 416 Score = 73.9 bits (180), Expect = 4e-11 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S+ DNIE AIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSS---DNIE-AIRRLKINDNWDRDAAAQSTQYPDRPG 45 >ref|XP_006595836.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like isoform X3 [Glycine max] Length = 416 Score = 73.9 bits (180), Expect = 4e-11 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MPENRQVLRNA S+ DNIE AIRRLKINDN DRDAAAQST YPDRPG Sbjct: 1 MPENRQVLRNADSS---DNIE-AIRRLKINDNWDRDAAAQSTQYPDRPG 45 >ref|XP_008229811.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like [Prunus mume] Length = 459 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = -2 Query: 225 LKGSSGIDRTKHKKGPL-TISIFQRYQMPENRQVLRNAASNPSGDNIEEAIRRLKINDNR 49 L G + R K KG + T S+ MP+ RQ L+NA N S N+EEA RL INDN+ Sbjct: 3 LIGETERSRAKQNKGRVYTTSVLP---MPDTRQALKNAVPNQSDGNVEEAFWRLNINDNQ 59 Query: 48 DRDAAAQSTPYPDRPG 1 D AQS PYPDRPG Sbjct: 60 DGGGVAQSNPYPDRPG 75 >ref|XP_007049198.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 2 [Theobroma cacao] gi|508701459|gb|EOX93355.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 2 [Theobroma cacao] Length = 338 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MP+NRQV NA SN S DNIEEAI RLKINDN ++ST YPDRPG Sbjct: 1 MPDNRQVQNNAVSNQSADNIEEAILRLKINDNNQEVGYSKSTAYPDRPG 49 >ref|XP_007049197.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma cacao] gi|508701458|gb|EOX93354.1| Zinc finger C-x8-C-x5-C-x3-H type family protein isoform 1 [Theobroma cacao] Length = 438 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MP+NRQV NA SN S DNIEEAI RLKINDN ++ST YPDRPG Sbjct: 1 MPDNRQVQNNAVSNQSADNIEEAILRLKINDNNQEVGYSKSTAYPDRPG 49 >gb|KDO59558.1| hypothetical protein CISIN_1g013033mg [Citrus sinensis] Length = 416 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MP+NRQV NA +N S DNIEEAI RLKI+DN++ AQ++PYP RPG Sbjct: 1 MPDNRQVKSNAVANQSADNIEEAIWRLKIHDNQEGGGVAQASPYPARPG 49 >gb|KDO59557.1| hypothetical protein CISIN_1g013033mg [Citrus sinensis] Length = 418 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MP+NRQV NA +N S DNIEEAI RLKI+DN++ AQ++PYP RPG Sbjct: 1 MPDNRQVKSNAVANQSADNIEEAIWRLKIHDNQEGGGVAQASPYPARPG 49 >ref|XP_006447662.1| hypothetical protein CICLE_v10015215mg [Citrus clementina] gi|568830635|ref|XP_006469597.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like [Citrus sinensis] gi|557550273|gb|ESR60902.1| hypothetical protein CICLE_v10015215mg [Citrus clementina] gi|641840637|gb|KDO59556.1| hypothetical protein CISIN_1g013033mg [Citrus sinensis] Length = 451 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MP+NRQV NA +N S DNIEEAI RLKI+DN++ AQ++PYP RPG Sbjct: 1 MPDNRQVKSNAVANQSADNIEEAIWRLKIHDNQEGGGVAQASPYPARPG 49 >ref|XP_012472851.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like isoform X2 [Gossypium raimondii] Length = 434 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -2 Query: 147 MPENRQVLRNAASNPSGDNIEEAIRRLKINDNRDRDAAAQSTPYPDRPG 1 MP+NRQV N SN S DNIEEAI RLKINDN ++S YPDRPG Sbjct: 1 MPDNRQVQNNVVSNQSADNIEEAILRLKINDNNQEVGVSKSVSYPDRPG 49