BLASTX nr result
ID: Wisteria21_contig00017531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00017531 (317 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013453607.1| hypothetical protein MTR_5g024973 [Medicago ... 75 2e-11 ref|XP_003624604.2| transmembrane protein, putative [Medicago tr... 70 8e-10 ref|XP_003624943.1| hypothetical protein MTR_7g089270 [Medicago ... 69 1e-09 gb|ABN09802.1| hypothetical protein MtrDRAFT_AC167711g44v2 [Medi... 69 1e-09 gb|ABN09822.1| hypothetical protein MtrDRAFT_AC167711g28v2 [Medi... 69 1e-09 emb|CDP20466.1| unnamed protein product [Coffea canephora] 68 3e-09 ref|XP_007161701.1| hypothetical protein PHAVU_001G090900g [Phas... 65 3e-08 ref|XP_003624941.1| hypothetical protein MTR_7g089250 [Medicago ... 64 3e-08 ref|XP_013447472.1| hypothetical protein MTR_7g007390 [Medicago ... 60 5e-07 ref|XP_012846375.1| PREDICTED: methionine--tRNA ligase, mitochon... 57 7e-06 gb|KJB22935.1| hypothetical protein B456_004G074800 [Gossypium r... 57 7e-06 >ref|XP_013453607.1| hypothetical protein MTR_5g024973 [Medicago truncatula] gi|657384298|gb|KEH27642.1| hypothetical protein MTR_5g024973 [Medicago truncatula] Length = 96 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 10 AINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRSC 135 A+NHALITRS FI QT VPVSLE+KDTVVR+YRTDPVQVRSC Sbjct: 27 AVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRTDPVQVRSC 68 >ref|XP_003624604.2| transmembrane protein, putative [Medicago truncatula] gi|657378988|gb|AES80822.2| transmembrane protein, putative [Medicago truncatula] Length = 263 Score = 69.7 bits (169), Expect = 8e-10 Identities = 42/78 (53%), Positives = 55/78 (70%), Gaps = 2/78 (2%) Frame = +1 Query: 4 HRAINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRSCPS-LSVSGYKNSRVLL 180 HR +NHALITRS + Q VPVSLE+KDTVVR+YRTDPVQV + S L + +S+V + Sbjct: 81 HRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQVMNLGSCLPRNRSCSSKVPV 140 Query: 181 SAI-NVGLSLALGKSVSN 231 S + N+G SL +S S+ Sbjct: 141 SLVMNLGSSLPRNQSYSS 158 >ref|XP_003624943.1| hypothetical protein MTR_7g089270 [Medicago truncatula] gi|355499958|gb|AES81161.1| hypothetical protein MTR_7g089270 [Medicago truncatula] Length = 95 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 10 AINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRS 132 A+NHALI RS FI QT VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 55 AVNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDPVQVRS 95 >gb|ABN09802.1| hypothetical protein MtrDRAFT_AC167711g44v2 [Medicago truncatula] Length = 83 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 4 HRAINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRS 132 HR +NHALITRS + Q VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 41 HRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQVRS 83 >gb|ABN09822.1| hypothetical protein MtrDRAFT_AC167711g28v2 [Medicago truncatula] Length = 119 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +1 Query: 4 HRAINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRS 132 HR +NHALITRS + Q VPVSLE+KDTVVR+YRTDPVQVRS Sbjct: 77 HRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDPVQVRS 119 >emb|CDP20466.1| unnamed protein product [Coffea canephora] Length = 63 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 7 RAINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRS 132 RA+NHAL+ RS FI QT PVSLELKDT VRAYRTDPVQVRS Sbjct: 22 RAVNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTDPVQVRS 63 >ref|XP_007161701.1| hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] gi|561035165|gb|ESW33695.1| hypothetical protein PHAVU_001G090900g [Phaseolus vulgaris] Length = 65 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = +1 Query: 4 HRAINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRS 132 H INH LIT S FI QT PVSLELKDT VRAYRTDPVQVRS Sbjct: 23 HLTINHGLITGSWFIHQTSDPVSLELKDTEVRAYRTDPVQVRS 65 >ref|XP_003624941.1| hypothetical protein MTR_7g089250 [Medicago truncatula] gi|355499956|gb|AES81159.1| hypothetical protein MTR_7g089250 [Medicago truncatula] Length = 93 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +1 Query: 10 AINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRSCPSLSVSGYKNSR 171 ++NHALI RS FI QT VPVSLE+KDTVVR+YRTDPVQ P + +S NSR Sbjct: 20 SVNHALIARSSFIIQTYVPVSLEIKDTVVRSYRTDPVQTGK-PLMVLSTDLNSR 72 >ref|XP_013447472.1| hypothetical protein MTR_7g007390 [Medicago truncatula] gi|657376475|gb|KEH21553.1| hypothetical protein MTR_7g007390 [Medicago truncatula] Length = 142 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 10 AINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQ 123 A+NHALITRS FI QT VPVSLE+KDTVVR+YR D VQ Sbjct: 44 AVNHALITRSWFIHQTYVPVSLEIKDTVVRSYRIDHVQ 81 >ref|XP_012846375.1| PREDICTED: methionine--tRNA ligase, mitochondrial, partial [Erythranthe guttatus] Length = 817 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 4 HRAINHALITRS*FISQTLVPVSLELKDTVVRAYRTDPVQVRSC 135 + +INHAL+ + I Q+ VSLE+KDT VRAYRTDPVQVRSC Sbjct: 207 NESINHALVEQPWLIHQSWFLVSLEVKDTEVRAYRTDPVQVRSC 250 >gb|KJB22935.1| hypothetical protein B456_004G074800 [Gossypium raimondii] Length = 100 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -3 Query: 138 WARPYLNRICSIGSYNCILEF*GDRNQSLADES*PRDQSVIDGSMI 1 WARPYLNRICSIGSY C L+F DR SL DE D SVI G ++ Sbjct: 11 WARPYLNRICSIGSYLCFLKFKRDRIPSLVDEPRLCDLSVITGPVM 56