BLASTX nr result
ID: Wisteria21_contig00017190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00017190 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011039831.1| PREDICTED: BTB/POZ domain-containing protein... 65 2e-08 ref|XP_008218921.1| PREDICTED: BTB/POZ domain-containing protein... 65 3e-08 ref|XP_007205531.1| hypothetical protein PRUPE_ppa008513mg [Prun... 65 3e-08 gb|AIU50127.1| BTB/POZ domain-containing protein, partial [Prunu... 64 3e-08 ref|XP_002299061.1| BTB/POZ domain-containing family protein [Po... 64 3e-08 ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein... 64 3e-08 gb|AIU50126.1| BTB/POZ domain-containing protein, partial [Popul... 64 4e-08 ref|XP_012078497.1| PREDICTED: BTB/POZ domain-containing protein... 64 4e-08 gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus lon... 63 8e-08 ref|XP_004500161.1| PREDICTED: BTB/POZ domain-containing protein... 62 1e-07 ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein... 62 2e-07 ref|XP_006495199.1| PREDICTED: BTB/POZ domain-containing protein... 62 2e-07 ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citr... 62 2e-07 ref|XP_006452706.1| hypothetical protein CICLE_v10008898mg [Citr... 62 2e-07 ref|XP_006452705.1| hypothetical protein CICLE_v10008898mg [Citr... 62 2e-07 gb|AIU50105.1| BTB/POZ domain-containing protein, partial [Citru... 61 3e-07 ref|XP_007146672.1| hypothetical protein PHAVU_006G059800g [Phas... 61 3e-07 ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein... 61 3e-07 ref|XP_012444070.1| PREDICTED: BTB/POZ domain-containing protein... 61 4e-07 gb|KHG28422.1| hypothetical protein F383_10833 [Gossypium arboreum] 61 4e-07 >ref|XP_011039831.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Populus euphratica] Length = 330 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF +FLQ ADRDLI EVFHEVLNAW+ Sbjct: 293 KFGKIFDIRDDFNSFLQCADRDLIAEVFHEVLNAWK 328 >ref|XP_008218921.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Prunus mume] Length = 328 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKI+DI DDF AFL SADRDLI E+FHEVLNAW+ Sbjct: 291 KFGKIYDIQDDFNAFLLSADRDLIAEIFHEVLNAWK 326 >ref|XP_007205531.1| hypothetical protein PRUPE_ppa008513mg [Prunus persica] gi|462401173|gb|EMJ06730.1| hypothetical protein PRUPE_ppa008513mg [Prunus persica] Length = 328 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKI+DI DDF AFL SADRDLI E+FHEVLNAW+ Sbjct: 291 KFGKIYDIQDDFNAFLLSADRDLIAEIFHEVLNAWK 326 >gb|AIU50127.1| BTB/POZ domain-containing protein, partial [Prunus persica] Length = 317 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAW 107 KFGKI+DI DDF AFL SADRDLI E+FHEVLNAW Sbjct: 283 KFGKIYDIQDDFNAFLLSADRDLIAEIFHEVLNAW 317 >ref|XP_002299061.1| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|222846319|gb|EEE83866.1| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 330 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF +FLQ ADRDLI EVFHEVLN+W+ Sbjct: 293 KFGKIFDIRDDFNSFLQCADRDLIAEVFHEVLNSWK 328 >ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Vitis vinifera] Length = 328 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF AFLQ ADRDLI EVFHEVL AW+ Sbjct: 291 KFGKIFDIRDDFNAFLQCADRDLIAEVFHEVLTAWK 326 >gb|AIU50126.1| BTB/POZ domain-containing protein, partial [Populus trichocarpa] Length = 317 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAW 107 KFGKIFDI DDF +FLQ ADRDLI EVFHEVLN+W Sbjct: 283 KFGKIFDIRDDFNSFLQCADRDLIAEVFHEVLNSW 317 >ref|XP_012078497.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Jatropha curcas] gi|643722934|gb|KDP32631.1| hypothetical protein JCGZ_13181 [Jatropha curcas] Length = 328 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF AF+ ADRDLI EVFHEVLNAW+ Sbjct: 291 KFGKIFDIRDDFNAFMHCADRDLIAEVFHEVLNAWK 326 >gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus longan] Length = 328 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF AFLQ+ADR+LI E+FHEVL AW+ Sbjct: 291 KFGKIFDIQDDFNAFLQNADRELISEIFHEVLGAWK 326 >ref|XP_004500161.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Cicer arietinum] Length = 330 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIF+I DDF FLQ+ADRDLI EVFHEVL AW+ Sbjct: 293 KFGKIFEIRDDFSTFLQNADRDLIAEVFHEVLGAWK 328 >ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Fragaria vesca subsp. vesca] Length = 328 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF AFL ADR+LI E+FHEVLNAW+ Sbjct: 291 KFGKIFDIRDDFNAFLLCADRELIAEIFHEVLNAWK 326 >ref|XP_006495199.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] Length = 399 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF FLQ ADR+LI EVFHEVL AW+ Sbjct: 362 KFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWK 397 >ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|568841705|ref|XP_006474798.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] gi|557555933|gb|ESR65947.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|641855260|gb|KDO74054.1| hypothetical protein CISIN_1g020253mg [Citrus sinensis] Length = 328 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF FLQ ADR+LI EVFHEVL AW+ Sbjct: 291 KFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWK 326 >ref|XP_006452706.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|557555932|gb|ESR65946.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 280 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF FLQ ADR+LI EVFHEVL AW+ Sbjct: 243 KFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWK 278 >ref|XP_006452705.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|557555931|gb|ESR65945.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|641855261|gb|KDO74055.1| hypothetical protein CISIN_1g020253mg [Citrus sinensis] Length = 263 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKIFDI DDF FLQ ADR+LI EVFHEVL AW+ Sbjct: 226 KFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWK 261 >gb|AIU50105.1| BTB/POZ domain-containing protein, partial [Citrus clementina] gi|700256986|gb|AIU50109.1| BTB/POZ domain-containing protein, partial [Citrus sinensis] Length = 317 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAW 107 KFGKIFDI DDF FLQ ADR+LI EVFHEVL AW Sbjct: 283 KFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAW 317 >ref|XP_007146672.1| hypothetical protein PHAVU_006G059800g [Phaseolus vulgaris] gi|561019895|gb|ESW18666.1| hypothetical protein PHAVU_006G059800g [Phaseolus vulgaris] Length = 328 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKI++I DDF FLQ+ADRDLI EVFHEVL+AW+ Sbjct: 291 KFGKIYEIRDDFNTFLQNADRDLIAEVFHEVLDAWK 326 >ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Glycine max] gi|947048897|gb|KRG98425.1| hypothetical protein GLYMA_18G072800 [Glycine max] Length = 328 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKI++I DDF FLQ+ADRDLI EVFHEVL+AW+ Sbjct: 291 KFGKIYEIRDDFNTFLQNADRDLIAEVFHEVLDAWK 326 >ref|XP_012444070.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Gossypium raimondii] gi|763796099|gb|KJB63095.1| hypothetical protein B456_009G453000 [Gossypium raimondii] Length = 328 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKI+DI DDF AFLQ ADR+LI ++FHEVLN W+ Sbjct: 291 KFGKIYDIRDDFHAFLQCADRELIADIFHEVLNTWK 326 >gb|KHG28422.1| hypothetical protein F383_10833 [Gossypium arboreum] Length = 325 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 KFGKIFDISDDFIAFLQSADRDLICEVFHEVLNAWE 110 KFGKI+DI DDF AFLQ ADR+LI ++FHEVLN W+ Sbjct: 288 KFGKIYDIRDDFHAFLQCADRELIADIFHEVLNTWK 323