BLASTX nr result
ID: Wisteria21_contig00016519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00016519 (475 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486860.1| PREDICTED: threonine synthase, chloroplastic... 60 5e-07 ref|XP_010087699.1| Threonine synthase [Morus notabilis] gi|5878... 58 3e-06 >ref|XP_004486860.1| PREDICTED: threonine synthase, chloroplastic-like [Cicer arietinum] Length = 531 Score = 60.5 bits (145), Expect = 5e-07 Identities = 43/89 (48%), Positives = 48/89 (53%), Gaps = 1/89 (1%) Frame = -2 Query: 264 NTNTKRCVPHPL-LKPKPSHFPVKAXXXXXXXXXXPLTQXXXXXXXXXXXXXXXXXSKQR 88 NTNTK P+ L + KP HF VK+ +Q SK R Sbjct: 15 NTNTK---PYSLPISTKPIHFTVKSQSQ---------SQPQPLTQNNTPTPSPSPSSKLR 62 Query: 87 RPADENIREEARRKNVSHSHLFSAKYVPF 1 RPADENIR+EARRKNVS HLFSAKYVPF Sbjct: 63 RPADENIRDEARRKNVS-QHLFSAKYVPF 90 >ref|XP_010087699.1| Threonine synthase [Morus notabilis] gi|587839008|gb|EXB29687.1| Threonine synthase [Morus notabilis] Length = 519 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 96 KQRRPADENIREEARRKNVSHSHLFSAKYVPF 1 K RRPADENIR+EARR N +HSH FSAKYVPF Sbjct: 48 KPRRPADENIRDEARRHNTTHSHHFSAKYVPF 79