BLASTX nr result
ID: Wisteria21_contig00016152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00016152 (551 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013464511.1| sodium bile acid symporter family protein [M... 70 5e-10 >ref|XP_013464511.1| sodium bile acid symporter family protein [Medicago truncatula] gi|657399029|gb|KEH38546.1| sodium bile acid symporter family protein [Medicago truncatula] Length = 681 Score = 70.5 bits (171), Expect = 5e-10 Identities = 40/64 (62%), Positives = 47/64 (73%) Frame = +2 Query: 20 IEVRYD*LLLPARCGLKLELAILLLVQFIGAITVAPLRLTRSCNIE*LQIFCIFYAFVVE 199 +EVRY+ LLLPAR G KLELA+LL IGAITVA LR+TRSCN E LQIF + + V + Sbjct: 231 VEVRYNQLLLPARYGPKLELAMLLFGSIIGAITVASLRVTRSCNREELQIFFVLFDGVNK 290 Query: 200 VNYA 211 YA Sbjct: 291 KIYA 294