BLASTX nr result
ID: Wisteria21_contig00014966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014966 (465 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004488156.1| PREDICTED: putative pectinesterase/pectinest... 73 1e-10 ref|XP_003595373.2| pectinesterase/pectinesterase inhibitor [Med... 68 2e-09 gb|KHN10486.1| Putative pectinesterase/pectinesterase inhibitor ... 60 5e-07 ref|XP_006587076.1| PREDICTED: probable pectinesterase/pectinest... 60 5e-07 gb|KOM39994.1| hypothetical protein LR48_Vigan04g019200 [Vigna a... 57 4e-06 ref|XP_006597897.1| PREDICTED: putative pectinesterase/pectinest... 57 7e-06 ref|XP_007138601.1| hypothetical protein PHAVU_009G222600g [Phas... 56 9e-06 >ref|XP_004488156.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 [Cicer arietinum] Length = 632 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 123 ALAPAWVSPVLELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 A P+W +PVLELPG+ EKPTPNVTVA+DGSGNFKTISEAL Sbjct: 302 ASPPSWATPVLELPGSTEKPTPNVTVAQDGSGNFKTISEAL 342 >ref|XP_003595373.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula] gi|657398046|gb|AES65624.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula] Length = 634 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 114 PAWVSPVLELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 P+W +P ++LPG+ EKPTPNVTVAKDGSG+FKTISEAL Sbjct: 307 PSWAAPAVDLPGSTEKPTPNVTVAKDGSGDFKTISEAL 344 >gb|KHN10486.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine soja] Length = 638 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 12/57 (21%) Frame = -1 Query: 135 SPGPALA------PAWVSPV------LELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 +PGP + PAW PV E G+ EKPTPNVTVAKDGSGNFKTISEAL Sbjct: 289 APGPVPSWAAGSIPAWAGPVSVWAGPAEFIGSNEKPTPNVTVAKDGSGNFKTISEAL 345 >ref|XP_006587076.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like [Glycine max] gi|947088927|gb|KRH37592.1| hypothetical protein GLYMA_09G076100 [Glycine max] Length = 573 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 12/57 (21%) Frame = -1 Query: 135 SPGPALA------PAWVSPV------LELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 +PGP + PAW PV E G+ EKPTPNVTVAKDGSGNFKTISEAL Sbjct: 224 APGPVPSWAAGSIPAWAGPVPVWAGPAEFIGSNEKPTPNVTVAKDGSGNFKTISEAL 280 >gb|KOM39994.1| hypothetical protein LR48_Vigan04g019200 [Vigna angularis] Length = 632 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 132 PGPALA-PAWVSPVLELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 P P L PAW P E G+ EKPTPNVTVA+DGSG+FKTISEAL Sbjct: 296 PLPTLPIPAWAGPS-EFKGSDEKPTPNVTVAQDGSGDFKTISEAL 339 >ref|XP_006597897.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like isoform X1 [Glycine max] gi|571519798|ref|XP_006597898.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like isoform X2 [Glycine max] gi|947063368|gb|KRH12629.1| hypothetical protein GLYMA_15G183700 [Glycine max] Length = 654 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 114 PAWVSPVLELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 P W P E G+ EKPTPNVTVA+DGSGNFKTISEAL Sbjct: 325 PVWAGPS-EFLGSNEKPTPNVTVAQDGSGNFKTISEAL 361 >ref|XP_007138601.1| hypothetical protein PHAVU_009G222600g [Phaseolus vulgaris] gi|561011688|gb|ESW10595.1| hypothetical protein PHAVU_009G222600g [Phaseolus vulgaris] Length = 635 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -1 Query: 132 PGPALA---PAWVSPVLELPGTVEKPTPNVTVAKDGSGNFKTISEAL 1 P PA A PAW P + G+ EKPTPNVTVA+DGSG+FKTISEAL Sbjct: 297 PLPAWATPVPAWAGPS-DFVGSDEKPTPNVTVAQDGSGDFKTISEAL 342