BLASTX nr result
ID: Wisteria21_contig00014773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014773 (201 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010064839.1| PREDICTED: GTP-binding protein SAR1A-like [E... 57 4e-06 >ref|XP_010064839.1| PREDICTED: GTP-binding protein SAR1A-like [Eucalyptus grandis] Length = 357 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -1 Query: 201 VFMCSIVRKMGYGDGFKWLSQYIK*FVSKRWKFIPIVMDWRCR 73 VFMCS+VRKMGYG+GFKW+SQYIK +S R + ++M++ CR Sbjct: 170 VFMCSVVRKMGYGEGFKWMSQYIKVDMS-RQSILVLLMNFLCR 211