BLASTX nr result
ID: Wisteria21_contig00014544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014544 (465 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004487325.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_004487324.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 >ref|XP_004487325.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900 isoform X2 [Cicer arietinum] Length = 362 Score = 65.9 bits (159), Expect = 1e-08 Identities = 36/47 (76%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +3 Query: 327 AAIARSLSRFHFNFR-SSLLTTIRFQAFSTEASLDKERVTNEVLKEF 464 A I+RSLSRFHFNFR LLT+I +AFSTEASLDKER+T EVLKEF Sbjct: 5 ATISRSLSRFHFNFRYPPLLTSICLRAFSTEASLDKERMTCEVLKEF 51 >ref|XP_004487324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11900 isoform X1 [Cicer arietinum] Length = 362 Score = 63.9 bits (154), Expect = 4e-08 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +3 Query: 327 AAIARSLSRFHFNFR-SSLLTTIRFQAFSTEASLDKERVTNEVLKEF 464 A I+ SLSRFHFNFR +LLT+I +AFSTEASLDKER+T EVLKEF Sbjct: 5 APISMSLSRFHFNFRYPTLLTSICLRAFSTEASLDKERMTCEVLKEF 51