BLASTX nr result
ID: Wisteria21_contig00014535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014535 (551 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504306.1| PREDICTED: uncharacterized protein LOC101501... 66 9e-09 >ref|XP_004504306.1| PREDICTED: uncharacterized protein LOC101501297 [Cicer arietinum] Length = 359 Score = 66.2 bits (160), Expect = 9e-09 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = -3 Query: 153 MLILQTSVVPRSFSPFRTTKVNGSLECFSHLGFLSYSPVSTHHAVKPLSCS 1 MLILQT++V SFSPFR TKV S E FSH LSYS +STHH VKP+S S Sbjct: 1 MLILQTAIVHGSFSPFRKTKVYSSHESFSHSQSLSYSTISTHHIVKPVSIS 51