BLASTX nr result
ID: Wisteria21_contig00014526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014526 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007153705.1| hypothetical protein PHAVU_003G057900g [Phas... 74 3e-11 >ref|XP_007153705.1| hypothetical protein PHAVU_003G057900g [Phaseolus vulgaris] gi|561027059|gb|ESW25699.1| hypothetical protein PHAVU_003G057900g [Phaseolus vulgaris] Length = 75 Score = 74.3 bits (181), Expect = 3e-11 Identities = 44/75 (58%), Positives = 50/75 (66%), Gaps = 3/75 (4%) Frame = -3 Query: 271 RFWLCTILVLCLVLA-SESRSLPSSFEGHATKSTEFPLGADGIFKVVSGLK--GMENAQP 101 + WLC ILVLC +A SE RSLPSSFE TKS +F L ADGI V G K EN + Sbjct: 5 KMWLCIILVLCSFVAISEQRSLPSSFESRTTKS-DFTLDADGI---VIGFKHKATENIKH 60 Query: 100 EPNRLSPMGPDPRHH 56 + NRLSP GPDP+HH Sbjct: 61 KLNRLSPSGPDPKHH 75