BLASTX nr result
ID: Wisteria21_contig00014501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014501 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ83789.1| unknown [Medicago truncatula] 74 3e-11 gb|AFK33705.1| unknown [Medicago truncatula] 74 3e-11 ref|XP_003624861.1| alpha-L-arabinofuranosidase [Medicago trunca... 74 3e-11 ref|XP_004493304.1| PREDICTED: alpha-L-arabinofuranosidase 1-lik... 72 1e-10 gb|KHN34572.1| Alpha-L-arabinofuranosidase 1 [Glycine soja] 72 2e-10 ref|XP_003554088.1| PREDICTED: alpha-L-arabinofuranosidase 1-lik... 72 2e-10 gb|KHN38809.1| Alpha-L-arabinofuranosidase 1 [Glycine soja] 66 1e-08 ref|XP_003521095.1| PREDICTED: alpha-L-arabinofuranosidase 1-lik... 66 1e-08 gb|KOM38684.1| hypothetical protein LR48_Vigan03g206600 [Vigna a... 65 2e-08 ref|XP_014491305.1| PREDICTED: alpha-L-arabinofuranosidase 1-lik... 63 1e-07 ref|XP_007162005.1| hypothetical protein PHAVU_001G115700g [Phas... 60 5e-07 ref|XP_002523672.1| Alpha-N-arabinofuranosidase 1 precursor, put... 57 5e-06 >gb|ACJ83789.1| unknown [Medicago truncatula] Length = 179 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQ+VGKDMNV+VPPHSFTS DLL ESSNLKM SDSS WSSI Sbjct: 136 SLLQSVGKDMNVIVPPHSFTSFDLLKESSNLKMLESDSSSWSSI 179 >gb|AFK33705.1| unknown [Medicago truncatula] Length = 179 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQ+VGKDMNV+VPPHSFTS DLL ESSNLKM SDSS WSSI Sbjct: 136 SLLQSVGKDMNVIVPPHSFTSFDLLKESSNLKMLESDSSSWSSI 179 >ref|XP_003624861.1| alpha-L-arabinofuranosidase [Medicago truncatula] gi|296882314|gb|ADH83380.1| alpha-L-arabinofuranosidase [Medicago truncatula] gi|355499876|gb|AES81079.1| alpha-L-arabinofuranosidase [Medicago truncatula] Length = 672 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQ+VGKDMNV+VPPHSFTS DLL ESSNLKM SDSS WSSI Sbjct: 629 SLLQSVGKDMNVIVPPHSFTSFDLLKESSNLKMLESDSSSWSSI 672 >ref|XP_004493304.1| PREDICTED: alpha-L-arabinofuranosidase 1-like [Cicer arietinum] Length = 676 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SL+Q+VGKDMNV+V PHSFT LDLL ESSNLKM GSDSS WSSI Sbjct: 633 SLVQSVGKDMNVIVAPHSFTLLDLLKESSNLKMPGSDSSTWSSI 676 >gb|KHN34572.1| Alpha-L-arabinofuranosidase 1 [Glycine soja] Length = 676 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/44 (81%), Positives = 37/44 (84%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQNV KDMNV VPP SFTS DLL +SSNLKM GSDSS WSSI Sbjct: 633 SLLQNVEKDMNVTVPPRSFTSFDLLKQSSNLKMAGSDSSTWSSI 676 >ref|XP_003554088.1| PREDICTED: alpha-L-arabinofuranosidase 1-like [Glycine max] gi|947045389|gb|KRG95018.1| hypothetical protein GLYMA_19G124500 [Glycine max] Length = 676 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/44 (81%), Positives = 37/44 (84%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQNV KDMNV VPP SFTS DLL +SSNLKM GSDSS WSSI Sbjct: 633 SLLQNVEKDMNVTVPPRSFTSFDLLKQSSNLKMAGSDSSTWSSI 676 >gb|KHN38809.1| Alpha-L-arabinofuranosidase 1 [Glycine soja] Length = 676 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQNVGKDMNV VPP SFTS DL+ +SS LKM GSDSS SSI Sbjct: 633 SLLQNVGKDMNVTVPPRSFTSFDLVKQSSTLKMAGSDSSTRSSI 676 >ref|XP_003521095.1| PREDICTED: alpha-L-arabinofuranosidase 1-like isoform X1 [Glycine max] gi|571445276|ref|XP_006576758.1| PREDICTED: alpha-L-arabinofuranosidase 1-like isoform X2 [Glycine max] gi|947118400|gb|KRH66649.1| hypothetical protein GLYMA_03G120000 [Glycine max] gi|947118401|gb|KRH66650.1| hypothetical protein GLYMA_03G120000 [Glycine max] gi|947118402|gb|KRH66651.1| hypothetical protein GLYMA_03G120000 [Glycine max] gi|947118403|gb|KRH66652.1| hypothetical protein GLYMA_03G120000 [Glycine max] Length = 676 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 SLLQNVGKDMNV VPP SFTS DL+ +SS LKM GSDSS SSI Sbjct: 633 SLLQNVGKDMNVTVPPRSFTSFDLVKQSSTLKMAGSDSSTRSSI 676 >gb|KOM38684.1| hypothetical protein LR48_Vigan03g206600 [Vigna angularis] Length = 673 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -1 Query: 227 LQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 LQNVGKD+NV VPP SFTS DLL ESSNLK GS SS WSS+ Sbjct: 632 LQNVGKDLNVTVPPRSFTSFDLLKESSNLKRKGSGSSTWSSM 673 >ref|XP_014491305.1| PREDICTED: alpha-L-arabinofuranosidase 1-like [Vigna radiata var. radiata] Length = 674 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 227 LQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 LQNVGKD+NV VP SFTS DLL ESS+LK GSDSS WSS+ Sbjct: 633 LQNVGKDLNVTVPARSFTSFDLLKESSDLKRKGSDSSTWSSM 674 >ref|XP_007162005.1| hypothetical protein PHAVU_001G115700g [Phaseolus vulgaris] gi|561035469|gb|ESW33999.1| hypothetical protein PHAVU_001G115700g [Phaseolus vulgaris] Length = 677 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSS 117 S LQNVGKD+NV +PP SFTS DLL ESSNL+M GS+SS Sbjct: 633 SRLQNVGKDLNVTIPPRSFTSFDLLKESSNLRMNGSNSS 671 >ref|XP_002523672.1| Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis] gi|223537072|gb|EEF38707.1| Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis] Length = 678 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -1 Query: 233 SLLQNVGKDMNVMVPPHSFTSLDLLIESSNLKMTGSDSSRWSSI 102 S+L + GKDM+V++PP+S TS DLL ESSN+K+TG+DS SSI Sbjct: 635 SMLDHAGKDMDVVLPPYSLTSYDLLTESSNIKITGTDSLSRSSI 678