BLASTX nr result
ID: Wisteria21_contig00014425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014425 (883 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013446175.1| hypothetical protein MTR_8g069785 [Medicago ... 49 2e-07 >ref|XP_013446175.1| hypothetical protein MTR_8g069785 [Medicago truncatula] gi|657374674|gb|KEH20202.1| hypothetical protein MTR_8g069785 [Medicago truncatula] Length = 103 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 335 LLPLRSYQLVLFHITQFAAD*NPVFSSVSA 246 ++PLRSYQLV+FH+ QFAA+ NPVFSSV A Sbjct: 73 VVPLRSYQLVMFHVPQFAAEKNPVFSSVYA 102 Score = 35.0 bits (79), Expect(2) = 2e-07 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = -1 Query: 472 AFGCSLANRQVTKRQWTPLGDLMAIYDSIVVLL 374 +FG L NRQVTKR+WT L + + D VV L Sbjct: 44 SFGYRLVNRQVTKRRWTALERIYIVIDKDVVPL 76