BLASTX nr result
ID: Wisteria21_contig00014313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014313 (259 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010653300.1| PREDICTED: putative potassium transporter 12... 57 5e-06 ref|XP_013445933.1| potassium transporter-like protein [Medicago... 57 5e-06 emb|CAN75896.1| hypothetical protein VITISV_038659 [Vitis vinifera] 57 5e-06 ref|XP_011086543.1| PREDICTED: putative potassium transporter 12... 57 7e-06 emb|CAD20577.1| putative potassium transporter [Vicia faba] 56 9e-06 >ref|XP_010653300.1| PREDICTED: putative potassium transporter 12 [Vitis vinifera] Length = 833 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 103 PWS---NEEGREGHGSIRRRLVKNSKRVDSFDVEAME 2 PWS ++EGREG+GSIRRRLVK KR DSFDVEAME Sbjct: 39 PWSLFGDDEGREGYGSIRRRLVKKPKRADSFDVEAME 75 >ref|XP_013445933.1| potassium transporter-like protein [Medicago truncatula] gi|657374387|gb|KEH19960.1| potassium transporter-like protein [Medicago truncatula] Length = 840 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = -1 Query: 103 PWSNE--EGREGHGSIRRRLVKNSKRVDSFDVEAME 2 PWS+ +GREG+GSIRRRLVK KRVDSFDVEAME Sbjct: 39 PWSHHGRDGREGYGSIRRRLVKKPKRVDSFDVEAME 74 >emb|CAN75896.1| hypothetical protein VITISV_038659 [Vitis vinifera] Length = 889 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 103 PWS---NEEGREGHGSIRRRLVKNSKRVDSFDVEAME 2 PWS ++EGREG+GSIRRRLVK KR DSFDVEAME Sbjct: 39 PWSLFGDDEGREGYGSIRRRLVKKPKRADSFDVEAME 75 >ref|XP_011086543.1| PREDICTED: putative potassium transporter 12 [Sesamum indicum] Length = 848 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/39 (71%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = -1 Query: 109 PHPWS---NEEGREGHGSIRRRLVKNSKRVDSFDVEAME 2 P PW+ +EE REG+GS+RRRLVK KRVDSFDVEAME Sbjct: 45 PPPWALFGDEEVREGYGSVRRRLVKKPKRVDSFDVEAME 83 >emb|CAD20577.1| putative potassium transporter [Vicia faba] Length = 837 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -1 Query: 103 PWSNE----EGREGHGSIRRRLVKNSKRVDSFDVEAME 2 PWS + +GREG+GSIRRRLVK KRVDSFDVEAME Sbjct: 38 PWSTKSKGSDGREGYGSIRRRLVKKPKRVDSFDVEAME 75