BLASTX nr result
ID: Wisteria21_contig00014005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00014005 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014515850.1| PREDICTED: protein transport protein yos1-li... 78 2e-12 ref|XP_003604822.1| Yos1-like protein [Medicago truncatula] gi|3... 77 5e-12 gb|KOM58279.1| hypothetical protein LR48_Vigan11g131300 [Vigna a... 76 9e-12 gb|KRH65980.1| hypothetical protein GLYMA_03G074700 [Glycine max] 75 1e-11 ref|XP_006576185.1| PREDICTED: uncharacterized protein LOC100500... 75 1e-11 ref|XP_003516928.2| PREDICTED: immediate early response 3-intera... 75 1e-11 ref|XP_006573329.1| PREDICTED: immediate early response 3-intera... 75 1e-11 ref|XP_006573330.1| PREDICTED: immediate early response 3-intera... 75 1e-11 ref|XP_004506642.1| PREDICTED: immediate early response 3-intera... 75 2e-11 ref|NP_001237493.1| uncharacterized protein LOC100500402 [Glycin... 74 3e-11 ref|XP_007133957.1| hypothetical protein PHAVU_010G006600g [Phas... 72 1e-10 gb|AFK35870.1| unknown [Medicago truncatula] 70 5e-10 ref|XP_012087946.1| PREDICTED: protein transport protein yos1-li... 69 1e-09 ref|XP_002323546.1| hypothetical protein POPTR_0016s11680g [Popu... 69 1e-09 ref|XP_002527879.1| conserved hypothetical protein [Ricinus comm... 68 2e-09 ref|XP_007026822.1| Yos1-like protein [Theobroma cacao] gi|50871... 66 1e-08 ref|XP_009370232.1| PREDICTED: protein transport protein yos1-li... 65 2e-08 ref|XP_008370042.1| PREDICTED: protein transport protein yos1-li... 65 2e-08 ref|XP_009358822.1| PREDICTED: protein transport protein yos1-li... 65 2e-08 ref|XP_008388107.1| PREDICTED: protein transport protein yos1-li... 65 3e-08 >ref|XP_014515850.1| PREDICTED: protein transport protein yos1-like [Vigna radiata var. radiata] gi|951033886|ref|XP_014515851.1| PREDICTED: protein transport protein yos1-like [Vigna radiata var. radiata] gi|951033889|ref|XP_014515852.1| PREDICTED: protein transport protein yos1-like [Vigna radiata var. radiata] gi|951033892|ref|XP_014515853.1| PREDICTED: protein transport protein yos1-like [Vigna radiata var. radiata] Length = 77 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNE+RFLAPRGWTLAEMTGPRRNSLKGQ++G IYACQ Sbjct: 19 ILNEERFLAPRGWTLAEMTGPRRNSLKGQIVGLIYACQ 56 >ref|XP_003604822.1| Yos1-like protein [Medicago truncatula] gi|355505877|gb|AES87019.1| Yos1-like protein [Medicago truncatula] Length = 192 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGPRRNSLKGQVIG IYACQ Sbjct: 134 ILNEDRFLARRGWTLAEMTGPRRNSLKGQVIGLIYACQ 171 >gb|KOM58279.1| hypothetical protein LR48_Vigan11g131300 [Vigna angularis] Length = 77 Score = 76.3 bits (186), Expect = 9e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNE+RFLAPRGWTLAEMTGPRR+SLKGQ++G IYACQ Sbjct: 19 ILNEERFLAPRGWTLAEMTGPRRSSLKGQIVGLIYACQ 56 >gb|KRH65980.1| hypothetical protein GLYMA_03G074700 [Glycine max] Length = 94 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQVIG IYACQ Sbjct: 36 ILNEDRFLARRGWTLAEMTGPQRNSLKGQVIGLIYACQ 73 >ref|XP_006576185.1| PREDICTED: uncharacterized protein LOC100500402 isoform X1 [Glycine max] gi|571443474|ref|XP_006576186.1| PREDICTED: uncharacterized protein LOC100500402 isoform X2 [Glycine max] Length = 95 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQVIG IYACQ Sbjct: 37 ILNEDRFLARRGWTLAEMTGPQRNSLKGQVIGLIYACQ 74 >ref|XP_003516928.2| PREDICTED: immediate early response 3-interacting protein 1-like isoformX1 [Glycine max] gi|947127935|gb|KRH75789.1| hypothetical protein GLYMA_01G109600 [Glycine max] Length = 111 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQVIG IYACQ Sbjct: 53 ILNEDRFLARRGWTLAEMTGPQRNSLKGQVIGLIYACQ 90 >ref|XP_006573329.1| PREDICTED: immediate early response 3-interacting protein 1-like isoform X2 [Glycine max] gi|947127936|gb|KRH75790.1| hypothetical protein GLYMA_01G109600 [Glycine max] Length = 112 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQVIG IYACQ Sbjct: 54 ILNEDRFLARRGWTLAEMTGPQRNSLKGQVIGLIYACQ 91 >ref|XP_006573330.1| PREDICTED: immediate early response 3-interacting protein 1-like isoform X3 [Glycine max] gi|571434924|ref|XP_006573331.1| PREDICTED: immediate early response 3-interacting protein 1-like isoform X4 [Glycine max] gi|571443476|ref|XP_006576187.1| PREDICTED: uncharacterized protein LOC100500402 isoform X3 [Glycine max] gi|571443478|ref|XP_006576188.1| PREDICTED: uncharacterized protein LOC100500402 isoform X4 [Glycine max] gi|571443480|ref|XP_006576189.1| PREDICTED: uncharacterized protein LOC100500402 isoform X5 [Glycine max] gi|571443482|ref|XP_006576190.1| PREDICTED: uncharacterized protein LOC100500402 isoform X6 [Glycine max] gi|734306684|gb|KHM98941.1| Immediate early response 3-interacting protein 1 [Glycine soja] gi|734389237|gb|KHN26221.1| Immediate early response 3-interacting protein 1 [Glycine soja] gi|947117732|gb|KRH65981.1| hypothetical protein GLYMA_03G074700 [Glycine max] gi|947117733|gb|KRH65982.1| hypothetical protein GLYMA_03G074700 [Glycine max] gi|947117734|gb|KRH65983.1| hypothetical protein GLYMA_03G074700 [Glycine max] gi|947117735|gb|KRH65984.1| hypothetical protein GLYMA_03G074700 [Glycine max] gi|947117736|gb|KRH65985.1| hypothetical protein GLYMA_03G074700 [Glycine max] Length = 77 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQVIG IYACQ Sbjct: 19 ILNEDRFLARRGWTLAEMTGPQRNSLKGQVIGLIYACQ 56 >ref|XP_004506642.1| PREDICTED: immediate early response 3-interacting protein 1 [Cicer arietinum] gi|502146867|ref|XP_004506643.1| PREDICTED: immediate early response 3-interacting protein 1 [Cicer arietinum] gi|828322164|ref|XP_012572973.1| PREDICTED: immediate early response 3-interacting protein 1 [Cicer arietinum] Length = 77 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQ+IG IYACQ Sbjct: 19 ILNEDRFLARRGWTLAEMTGPQRNSLKGQIIGLIYACQ 56 >ref|NP_001237493.1| uncharacterized protein LOC100500402 [Glycine max] gi|255630238|gb|ACU15474.1| unknown [Glycine max] Length = 94 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTGP+RNSLKGQV+G IYACQ Sbjct: 36 ILNEDRFLARRGWTLAEMTGPQRNSLKGQVMGLIYACQ 73 >ref|XP_007133957.1| hypothetical protein PHAVU_010G006600g [Phaseolus vulgaris] gi|561007002|gb|ESW05951.1| hypothetical protein PHAVU_010G006600g [Phaseolus vulgaris] Length = 77 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNE+RFLAPRGWTL +MT PRRNSLKGQ+IG IYACQ Sbjct: 19 ILNEERFLAPRGWTLRDMTEPRRNSLKGQIIGLIYACQ 56 >gb|AFK35870.1| unknown [Medicago truncatula] Length = 77 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAEMTG R NSLKGQVIG IYACQ Sbjct: 19 ILNEDRFLARRGWTLAEMTGLRGNSLKGQVIGLIYACQ 56 >ref|XP_012087946.1| PREDICTED: protein transport protein yos1-like [Jatropha curcas] gi|802751111|ref|XP_012087947.1| PREDICTED: protein transport protein yos1-like [Jatropha curcas] gi|643710300|gb|KDP24507.1| hypothetical protein JCGZ_25071 [Jatropha curcas] Length = 77 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLAPRGWTLAE+ G +RNS+KGQ++G I+ACQ Sbjct: 19 ILNEDRFLAPRGWTLAELQGSKRNSIKGQIVGLIHACQ 56 >ref|XP_002323546.1| hypothetical protein POPTR_0016s11680g [Populus trichocarpa] gi|222868176|gb|EEF05307.1| hypothetical protein POPTR_0016s11680g [Populus trichocarpa] Length = 78 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLAPRGWTLAE+ G RNSLKGQ+IG ++ACQ Sbjct: 20 ILNEDRFLAPRGWTLAELQGSTRNSLKGQIIGLVHACQ 57 >ref|XP_002527879.1| conserved hypothetical protein [Ricinus communis] gi|223532730|gb|EEF34510.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLAPRGWTLAE+ RRNS+KGQ+IG I+ACQ Sbjct: 19 ILNEDRFLAPRGWTLAELQAGRRNSIKGQIIGLIHACQ 56 >ref|XP_007026822.1| Yos1-like protein [Theobroma cacao] gi|508715427|gb|EOY07324.1| Yos1-like protein [Theobroma cacao] Length = 77 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFLA RGWTLAE+ G RRN+LKGQ+IG I+ACQ Sbjct: 19 ILNEDRFLALRGWTLAEIQGGRRNTLKGQIIGLIHACQ 56 >ref|XP_009370232.1| PREDICTED: protein transport protein yos1-like [Pyrus x bretschneideri] gi|694389242|ref|XP_009370261.1| PREDICTED: protein transport protein yos1-like [Pyrus x bretschneideri] Length = 77 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFL PRGWTL ++ G RR +LKGQ+IGFI+ACQ Sbjct: 19 ILNEDRFLGPRGWTLLQLQGGRRTTLKGQIIGFIHACQ 56 >ref|XP_008370042.1| PREDICTED: protein transport protein yos1-like [Malus domestica] gi|657957109|ref|XP_008370043.1| PREDICTED: protein transport protein yos1-like [Malus domestica] Length = 77 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFL PRGWTL ++ G RR +LKGQ+IGFI+ACQ Sbjct: 19 ILNEDRFLGPRGWTLLQLQGGRRTTLKGQIIGFIHACQ 56 >ref|XP_009358822.1| PREDICTED: protein transport protein yos1-like [Pyrus x bretschneideri] gi|694355746|ref|XP_009358823.1| PREDICTED: protein transport protein yos1-like [Pyrus x bretschneideri] gi|694355750|ref|XP_009358824.1| PREDICTED: protein transport protein yos1-like [Pyrus x bretschneideri] Length = 77 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFL PRGWTL + G RR +LKGQ+IGFI+ACQ Sbjct: 19 ILNEDRFLGPRGWTLLQFQGERRTTLKGQIIGFIHACQ 56 >ref|XP_008388107.1| PREDICTED: protein transport protein yos1-like [Malus domestica] gi|657991740|ref|XP_008388109.1| PREDICTED: protein transport protein yos1-like [Malus domestica] gi|657991742|ref|XP_008388110.1| PREDICTED: protein transport protein yos1-like [Malus domestica] gi|658030109|ref|XP_008350505.1| PREDICTED: protein transport protein yos1-like [Malus domestica] gi|658030111|ref|XP_008350506.1| PREDICTED: protein transport protein yos1-like [Malus domestica] gi|658030113|ref|XP_008350507.1| PREDICTED: protein transport protein yos1-like [Malus domestica] Length = 77 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 271 ILNEDRFLAPRGWTLAEMTGPRRNSLKGQVIGFIYACQ 158 ILNEDRFL PRGWTL + G RR +LKGQ+IGFI+ACQ Sbjct: 19 ILNEDRFLGPRGWTLLQFQGGRRTTLKGQIIGFIHACQ 56