BLASTX nr result
ID: Wisteria21_contig00013082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00013082 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN44147.1| hypothetical protein glysoja_031808 [Glycine soja] 56 9e-06 ref|XP_006595150.1| PREDICTED: trichohyalin-like isoform X3 [Gly... 56 9e-06 ref|XP_006595149.1| PREDICTED: trichohyalin-like isoform X2 [Gly... 56 9e-06 ref|XP_006595148.1| PREDICTED: trichohyalin-like isoform X1 [Gly... 56 9e-06 >gb|KHN44147.1| hypothetical protein glysoja_031808 [Glycine soja] Length = 737 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 302 LARSESARVLRRIPPSPSLLQGMKKGVDYIRKK 204 L RSESAR LRRIP SPSLL G+KKGVDYIRKK Sbjct: 676 LPRSESARTLRRIPSSPSLLLGIKKGVDYIRKK 708 >ref|XP_006595150.1| PREDICTED: trichohyalin-like isoform X3 [Glycine max] gi|947074636|gb|KRH23527.1| hypothetical protein GLYMA_13G362100 [Glycine max] Length = 748 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 302 LARSESARVLRRIPPSPSLLQGMKKGVDYIRKK 204 L RSESAR LRRIP SPSLL G+KKGVDYIRKK Sbjct: 687 LPRSESARTLRRIPSSPSLLLGIKKGVDYIRKK 719 >ref|XP_006595149.1| PREDICTED: trichohyalin-like isoform X2 [Glycine max] Length = 753 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 302 LARSESARVLRRIPPSPSLLQGMKKGVDYIRKK 204 L RSESAR LRRIP SPSLL G+KKGVDYIRKK Sbjct: 692 LPRSESARTLRRIPSSPSLLLGIKKGVDYIRKK 724 >ref|XP_006595148.1| PREDICTED: trichohyalin-like isoform X1 [Glycine max] Length = 754 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 302 LARSESARVLRRIPPSPSLLQGMKKGVDYIRKK 204 L RSESAR LRRIP SPSLL G+KKGVDYIRKK Sbjct: 693 LPRSESARTLRRIPSSPSLLLGIKKGVDYIRKK 725