BLASTX nr result
ID: Wisteria21_contig00012361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00012361 (1117 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432011.1| hypothetical protein CICLE_v10003098mg [Citr... 66 6e-08 >ref|XP_006432011.1| hypothetical protein CICLE_v10003098mg [Citrus clementina] gi|557534133|gb|ESR45251.1| hypothetical protein CICLE_v10003098mg [Citrus clementina] Length = 182 Score = 65.9 bits (159), Expect = 6e-08 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 7/60 (11%) Frame = -2 Query: 1023 LKFGIERFDGKMNFGLWQKQVKDILIQSGLHKVLRG-------VGNLDTLKEIAQKEEQV 865 +KF IE+FDG++NFGLWQ QVKD+LIQSGLHK L+G G+ T KE+ +K E++ Sbjct: 10 VKFEIEKFDGRINFGLWQVQVKDVLIQSGLHKALKGKPSPASNSGSGKTTKELWEKLEKL 69