BLASTX nr result
ID: Wisteria21_contig00012284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00012284 (711 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp.... 63 2e-07 >ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297334222|gb|EFH64640.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 50 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +3 Query: 477 HYLFYWILRSLFMQDMIESDHRKDSLQANRPIPRRGLARWLEQRHI 614 H L YWILRS + + DHRKDSL+ N+PIP GL +WLEQRHI Sbjct: 3 HPLIYWILRSPLIHGSVGYDHRKDSLKVNQPIPCMGLTQWLEQRHI 48