BLASTX nr result
ID: Wisteria21_contig00011792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00011792 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442255.1| zinc finger A20 and AN1 domain stress-associ... 77 5e-12 gb|KHN07399.1| Zinc finger A20 and AN1 domain-containing stress-... 76 9e-12 ref|NP_001237386.1| uncharacterized protein LOC100306347 [Glycin... 76 9e-12 gb|AFK43974.1| unknown [Lotus japonicus] 76 1e-11 ref|XP_014514903.1| PREDICTED: zinc finger A20 and AN1 domain-co... 75 2e-11 ref|XP_008364799.1| PREDICTED: zinc finger A20 and AN1 domain-co... 75 2e-11 ref|XP_008373747.1| PREDICTED: zinc finger A20 and AN1 domain-co... 75 2e-11 ref|XP_006603655.1| PREDICTED: uncharacterized protein LOC100499... 74 3e-11 ref|XP_007145644.1| hypothetical protein PHAVU_007G256400g [Phas... 74 3e-11 ref|NP_001235357.1| uncharacterized protein LOC100499995 [Glycin... 74 3e-11 ref|XP_010105325.1| Zinc finger A20 and AN1 domain-containing st... 74 6e-11 ref|XP_007202662.1| hypothetical protein PRUPE_ppa012365mg [Prun... 74 6e-11 ref|XP_003625187.1| zinc finger A20 and AN1 domain stress-associ... 74 6e-11 ref|XP_009351048.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 7e-11 ref|XP_008392123.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 7e-11 ref|XP_008240842.1| PREDICTED: zinc finger A20 and AN1 domain-co... 73 7e-11 ref|XP_009349757.1| PREDICTED: zinc finger A20 and AN1 domain-co... 72 2e-10 ref|XP_004493535.1| PREDICTED: zinc finger A20 and AN1 domain-co... 72 2e-10 gb|KOM34142.1| hypothetical protein LR48_Vigan02g029200 [Vigna a... 72 2e-10 gb|KHG02934.1| Zinc finger A20 and AN1 domain-containing stress-... 72 2e-10 >ref|XP_013442255.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago truncatula] gi|657370052|gb|KEH16280.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago truncatula] Length = 177 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 110 HKIMESHDETGCQAPERPILCINNCGFFGRAATMNM 3 HKIM+SHDETGCQ PE PILC+NNCGFFGRAATMNM Sbjct: 6 HKIMDSHDETGCQTPELPILCVNNCGFFGRAATMNM 41 >gb|KHN07399.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Glycine soja] gi|947118749|gb|KRH66998.1| hypothetical protein GLYMA_03G140500 [Glycine max] Length = 170 Score = 76.3 bits (186), Expect = 9e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAPERPILCINNCGFFGRAATMNM Sbjct: 1 MESHDETGCQAPERPILCINNCGFFGRAATMNM 33 >ref|NP_001237386.1| uncharacterized protein LOC100306347 [Glycine max] gi|255628269|gb|ACU14479.1| unknown [Glycine max] Length = 170 Score = 76.3 bits (186), Expect = 9e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAPERPILCINNCGFFGRAATMNM Sbjct: 1 MESHDETGCQAPERPILCINNCGFFGRAATMNM 33 >gb|AFK43974.1| unknown [Lotus japonicus] Length = 172 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAPERPILC+NNCGFFGRAATMNM Sbjct: 1 MESHDETGCQAPERPILCVNNCGFFGRAATMNM 33 >ref|XP_014514903.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Vigna radiata var. radiata] Length = 172 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAPERPILCINNCGFFGRA+TMNM Sbjct: 1 MESHDETGCQAPERPILCINNCGFFGRASTMNM 33 >ref|XP_008364799.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Malus domestica] Length = 176 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAP+RPILC+NNCGFFGRAATMNM Sbjct: 1 MESHDETGCQAPDRPILCVNNCGFFGRAATMNM 33 >ref|XP_008373747.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Malus domestica] Length = 176 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAP+RPILC+NNCGFFGRAATMNM Sbjct: 1 MESHDETGCQAPDRPILCVNNCGFFGRAATMNM 33 >ref|XP_006603655.1| PREDICTED: uncharacterized protein LOC100499995 isoform X1 [Glycine max] gi|571552653|ref|XP_006603656.1| PREDICTED: uncharacterized protein LOC100499995 isoform X2 [Glycine max] gi|571552657|ref|XP_006603657.1| PREDICTED: uncharacterized protein LOC100499995 isoform X3 [Glycine max] gi|571552659|ref|XP_006603658.1| PREDICTED: uncharacterized protein LOC100499995 isoform X4 [Glycine max] gi|734389663|gb|KHN26348.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Glycine soja] gi|947045688|gb|KRG95317.1| hypothetical protein GLYMA_19G1432001 [Glycine max] gi|947045689|gb|KRG95318.1| hypothetical protein GLYMA_19G1432001 [Glycine max] gi|947045690|gb|KRG95319.1| hypothetical protein GLYMA_19G1432001 [Glycine max] gi|947045691|gb|KRG95320.1| hypothetical protein GLYMA_19G1432001 [Glycine max] gi|947045692|gb|KRG95321.1| hypothetical protein GLYMA_19G1432001 [Glycine max] Length = 172 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 ME HDETGCQAPERPILCINNCGFFGRAATMNM Sbjct: 1 MEPHDETGCQAPERPILCINNCGFFGRAATMNM 33 >ref|XP_007145644.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris] gi|593690088|ref|XP_007145645.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris] gi|561018834|gb|ESW17638.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris] gi|561018835|gb|ESW17639.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris] Length = 172 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAPERPILC NNCGFFGRAATMNM Sbjct: 1 MESHDETGCQAPERPILCTNNCGFFGRAATMNM 33 >ref|NP_001235357.1| uncharacterized protein LOC100499995 [Glycine max] gi|255628387|gb|ACU14538.1| unknown [Glycine max] Length = 156 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 ME HDETGCQAPERPILCINNCGFFGRAATMNM Sbjct: 1 MEPHDETGCQAPERPILCINNCGFFGRAATMNM 33 >ref|XP_010105325.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Morus notabilis] gi|587916711|gb|EXC04346.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 8 [Morus notabilis] Length = 168 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAPERPILCINNCGFFGRAAT NM Sbjct: 1 MESHDETGCQAPERPILCINNCGFFGRAATNNM 33 >ref|XP_007202662.1| hypothetical protein PRUPE_ppa012365mg [Prunus persica] gi|462398193|gb|EMJ03861.1| hypothetical protein PRUPE_ppa012365mg [Prunus persica] Length = 172 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQ P+RPILCINNCGFFGRAATMNM Sbjct: 1 MESHDETGCQTPDRPILCINNCGFFGRAATMNM 33 >ref|XP_003625187.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago truncatula] gi|355500202|gb|AES81405.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago truncatula] Length = 260 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 107 KIMESHDETGCQAPERPILCINNCGFFGRAATMNM 3 ++MESHDE GCQAPERPILC+NNCGFFGR ATMNM Sbjct: 87 RVMESHDEMGCQAPERPILCVNNCGFFGREATMNM 121 >ref|XP_009351048.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Pyrus x bretschneideri] Length = 174 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAP+RPILC+NNCGFFGR ATMNM Sbjct: 1 MESHDETGCQAPDRPILCVNNCGFFGRVATMNM 33 >ref|XP_008392123.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Malus domestica] Length = 174 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQAP+RPILC+NNCGFFGR ATMNM Sbjct: 1 MESHDETGCQAPDRPILCVNNCGFFGRVATMNM 33 >ref|XP_008240842.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Prunus mume] Length = 172 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQ P+RPILC+NNCGFFGRAATMNM Sbjct: 1 MESHDETGCQTPDRPILCVNNCGFFGRAATMNM 33 >ref|XP_009349757.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Pyrus x bretschneideri] Length = 173 Score = 72.0 bits (175), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHD TGCQAP+RPILC+NNCGFFGRAATMNM Sbjct: 1 MESHDGTGCQAPDRPILCVNNCGFFGRAATMNM 33 >ref|XP_004493535.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Cicer arietinum] gi|502108975|ref|XP_004493537.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Cicer arietinum] Length = 172 Score = 72.0 bits (175), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDE GCQ PERPILC+NNCGFFGRAATMNM Sbjct: 1 MESHDEMGCQTPERPILCVNNCGFFGRAATMNM 33 >gb|KOM34142.1| hypothetical protein LR48_Vigan02g029200 [Vigna angularis] Length = 172 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 101 MESHDETGCQAPERPILCINNCGFFGRAATMNM 3 MESHDETGCQA ERPILCINNCGFFGRA+TMNM Sbjct: 1 MESHDETGCQARERPILCINNCGFFGRASTMNM 33 >gb|KHG02934.1| Zinc finger A20 and AN1 domain-containing stress-associated 8 [Gossypium arboreum] Length = 180 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 113 GHKIMESHDETGCQAPERPILCINNCGFFGRAATMNM 3 G + MESHDETGCQAPE PILCINNCGFFG AATMNM Sbjct: 5 GLEKMESHDETGCQAPEGPILCINNCGFFGSAATMNM 41