BLASTX nr result
ID: Wisteria21_contig00010496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010496 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007037075.1| Endosomal targeting BRO1-like domain-contain... 82 2e-13 ref|XP_007037076.1| Endosomal targeting BRO1-like domain-contain... 77 5e-12 ref|XP_007037074.1| Endosomal targeting BRO1-like domain-contain... 77 5e-12 ref|XP_004512802.1| PREDICTED: uncharacterized protein LOC101512... 77 6e-12 ref|XP_014511076.1| PREDICTED: uncharacterized protein LOC106769... 76 8e-12 gb|KOM54618.1| hypothetical protein LR48_Vigan10g051000 [Vigna a... 76 8e-12 ref|XP_007152520.1| hypothetical protein PHAVU_004G137200g [Phas... 76 8e-12 gb|KRH34273.1| hypothetical protein GLYMA_10G1738002, partial [G... 76 1e-11 gb|KHN14751.1| BRO1 domain-containing protein BROX [Glycine soja] 76 1e-11 ref|XP_006589244.1| PREDICTED: uncharacterized protein LOC100813... 76 1e-11 ref|XP_003556420.1| PREDICTED: uncharacterized protein LOC100781... 76 1e-11 ref|XP_006589242.1| PREDICTED: uncharacterized protein LOC100813... 76 1e-11 gb|KRH09358.1| hypothetical protein GLYMA_16G211100 [Glycine max... 75 1e-11 gb|KRH09356.1| hypothetical protein GLYMA_16G211100 [Glycine max... 75 1e-11 gb|KRH09352.1| hypothetical protein GLYMA_16G211100 [Glycine max... 75 1e-11 gb|KJB53015.1| hypothetical protein B456_008G293500 [Gossypium r... 75 1e-11 gb|KJB53014.1| hypothetical protein B456_008G293500 [Gossypium r... 75 1e-11 ref|XP_012440366.1| PREDICTED: uncharacterized protein LOC105765... 75 1e-11 gb|KHG08403.1| Interleukin-3 receptor class 2 subunit beta [Goss... 75 1e-11 ref|XP_004495492.1| PREDICTED: uncharacterized protein LOC101515... 75 1e-11 >ref|XP_007037075.1| Endosomal targeting BRO1-like domain-containing protein isoform 2 [Theobroma cacao] gi|508774320|gb|EOY21576.1| Endosomal targeting BRO1-like domain-containing protein isoform 2 [Theobroma cacao] Length = 441 Score = 82.0 bits (201), Expect = 2e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 133 STQDMGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 ++QDMGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 15 NSQDMGCLVSTPKDSGGNRRRPGNIGEISVYVPGLRIPKPVD 56 >ref|XP_007037076.1| Endosomal targeting BRO1-like domain-containing protein isoform 3, partial [Theobroma cacao] gi|508774321|gb|EOY21577.1| Endosomal targeting BRO1-like domain-containing protein isoform 3, partial [Theobroma cacao] Length = 350 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDSGGNRRRPGNIGEISVYVPGLRIPKPVD 38 >ref|XP_007037074.1| Endosomal targeting BRO1-like domain-containing protein isoform 1 [Theobroma cacao] gi|508774319|gb|EOY21575.1| Endosomal targeting BRO1-like domain-containing protein isoform 1 [Theobroma cacao] Length = 468 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDSGGNRRRPGNIGEISVYVPGLRIPKPVD 38 >ref|XP_004512802.1| PREDICTED: uncharacterized protein LOC101512481 [Cicer arietinum] gi|828332165|ref|XP_012574718.1| PREDICTED: uncharacterized protein LOC101512481 [Cicer arietinum] gi|828332168|ref|XP_012574719.1| PREDICTED: uncharacterized protein LOC101512481 [Cicer arietinum] Length = 426 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDSGGNRRKPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_014511076.1| PREDICTED: uncharacterized protein LOC106769815 [Vigna radiata var. radiata] gi|950932889|ref|XP_014511084.1| PREDICTED: uncharacterized protein LOC106769815 [Vigna radiata var. radiata] Length = 425 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCVVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >gb|KOM54618.1| hypothetical protein LR48_Vigan10g051000 [Vigna angularis] Length = 425 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCVVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_007152520.1| hypothetical protein PHAVU_004G137200g [Phaseolus vulgaris] gi|561025829|gb|ESW24514.1| hypothetical protein PHAVU_004G137200g [Phaseolus vulgaris] Length = 425 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCVVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >gb|KRH34273.1| hypothetical protein GLYMA_10G1738002, partial [Glycine max] Length = 229 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >gb|KHN14751.1| BRO1 domain-containing protein BROX [Glycine soja] Length = 425 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_006589244.1| PREDICTED: uncharacterized protein LOC100813397 isoform X3 [Glycine max] Length = 400 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_003556420.1| PREDICTED: uncharacterized protein LOC100781733 isoform X1 [Glycine max] gi|571569594|ref|XP_006606414.1| PREDICTED: uncharacterized protein LOC100781733 isoform X2 [Glycine max] gi|734324228|gb|KHN05003.1| hypothetical protein glysoja_013910 [Glycine soja] gi|947042797|gb|KRG92521.1| hypothetical protein GLYMA_20G216500 [Glycine max] gi|947042798|gb|KRG92522.1| hypothetical protein GLYMA_20G216500 [Glycine max] Length = 425 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_006589242.1| PREDICTED: uncharacterized protein LOC100813397 isoform X1 [Glycine max] gi|571483452|ref|XP_006589243.1| PREDICTED: uncharacterized protein LOC100813397 isoform X2 [Glycine max] Length = 425 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC VSTPKDSGGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCFVSTPKDSGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >gb|KRH09358.1| hypothetical protein GLYMA_16G211100 [Glycine max] gi|947059953|gb|KRH09359.1| hypothetical protein GLYMA_16G211100 [Glycine max] Length = 298 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VS PKDSGGNRR PG IGELSVYVPGLRIPKPVD Sbjct: 1 MGCVVSAPKDSGGNRRRPGSIGELSVYVPGLRIPKPVD 38 >gb|KRH09356.1| hypothetical protein GLYMA_16G211100 [Glycine max] gi|947059951|gb|KRH09357.1| hypothetical protein GLYMA_16G211100 [Glycine max] Length = 273 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VS PKDSGGNRR PG IGELSVYVPGLRIPKPVD Sbjct: 1 MGCVVSAPKDSGGNRRRPGSIGELSVYVPGLRIPKPVD 38 >gb|KRH09352.1| hypothetical protein GLYMA_16G211100 [Glycine max] gi|947059947|gb|KRH09353.1| hypothetical protein GLYMA_16G211100 [Glycine max] Length = 400 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VS PKDSGGNRR PG IGELSVYVPGLRIPKPVD Sbjct: 1 MGCVVSAPKDSGGNRRRPGSIGELSVYVPGLRIPKPVD 38 >gb|KJB53015.1| hypothetical protein B456_008G293500 [Gossypium raimondii] Length = 424 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKD+GGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDTGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >gb|KJB53014.1| hypothetical protein B456_008G293500 [Gossypium raimondii] Length = 367 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKD+GGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDTGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_012440366.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215221|ref|XP_012440367.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215223|ref|XP_012440368.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215225|ref|XP_012440369.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215227|ref|XP_012440370.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215229|ref|XP_012440371.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215231|ref|XP_012440372.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215233|ref|XP_012440373.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215235|ref|XP_012440374.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215237|ref|XP_012440375.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|823215239|ref|XP_012440376.1| PREDICTED: uncharacterized protein LOC105765706 [Gossypium raimondii] gi|763785941|gb|KJB53012.1| hypothetical protein B456_008G293500 [Gossypium raimondii] gi|763785942|gb|KJB53013.1| hypothetical protein B456_008G293500 [Gossypium raimondii] gi|763785945|gb|KJB53016.1| hypothetical protein B456_008G293500 [Gossypium raimondii] gi|763785946|gb|KJB53017.1| hypothetical protein B456_008G293500 [Gossypium raimondii] gi|763785947|gb|KJB53018.1| hypothetical protein B456_008G293500 [Gossypium raimondii] gi|763785948|gb|KJB53019.1| hypothetical protein B456_008G293500 [Gossypium raimondii] Length = 424 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKD+GGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDTGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >gb|KHG08403.1| Interleukin-3 receptor class 2 subunit beta [Gossypium arboreum] Length = 424 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGC+VSTPKD+GGNRR PG IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCLVSTPKDTGGNRRRPGSIGEVSVYVPGLRIPKPVD 38 >ref|XP_004495492.1| PREDICTED: uncharacterized protein LOC101515213 [Cicer arietinum] gi|502116567|ref|XP_004495493.1| PREDICTED: uncharacterized protein LOC101515213 [Cicer arietinum] gi|502116569|ref|XP_004495494.1| PREDICTED: uncharacterized protein LOC101515213 [Cicer arietinum] gi|828304148|ref|XP_012569988.1| PREDICTED: uncharacterized protein LOC101515213 [Cicer arietinum] gi|828304151|ref|XP_012569989.1| PREDICTED: uncharacterized protein LOC101515213 [Cicer arietinum] Length = 425 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 145 MGCMVSTPKDSGGNRRMPGGIGELSVYVPGLRIPKPVD 258 MGCMVSTPKDSGGNRR P IGE+SVYVPGLRIPKPVD Sbjct: 1 MGCMVSTPKDSGGNRRRPASIGEVSVYVPGLRIPKPVD 38