BLASTX nr result
ID: Wisteria21_contig00010444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010444 (207 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236363.1| uncharacterized protein LOC100527715 [Glycin... 57 4e-06 ref|NP_001236744.1| uncharacterized protein LOC100499840 [Glycin... 57 4e-06 >ref|NP_001236363.1| uncharacterized protein LOC100527715 [Glycine max] gi|571443518|ref|XP_006576208.1| PREDICTED: uncharacterized protein LOC100527715 isoform X1 [Glycine max] gi|571443520|ref|XP_006576209.1| PREDICTED: uncharacterized protein LOC100527715 isoform X2 [Glycine max] gi|255633032|gb|ACU16871.1| unknown [Glycine max] gi|734332452|gb|KHN07412.1| Outer envelope pore protein 16-3, chloroplastic/mitochondrial [Glycine soja] gi|947118788|gb|KRH67037.1| hypothetical protein GLYMA_03G142900 [Glycine max] gi|947118789|gb|KRH67038.1| hypothetical protein GLYMA_03G142900 [Glycine max] Length = 160 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MVDPAERRYLEDEDSSLMKTIKGATTGLVA 2 MVD AERRYLED+DSSLMKTIKGATTGLVA Sbjct: 1 MVDAAERRYLEDDDSSLMKTIKGATTGLVA 30 >ref|NP_001236744.1| uncharacterized protein LOC100499840 [Glycine max] gi|571552640|ref|XP_006603652.1| PREDICTED: uncharacterized protein LOC100499840 isoform X1 [Glycine max] gi|255627053|gb|ACU13871.1| unknown [Glycine max] gi|734389688|gb|KHN26373.1| Outer envelope pore protein 16-3, chloroplastic/mitochondrial [Glycine soja] gi|947045731|gb|KRG95360.1| hypothetical protein GLYMA_19G145900 [Glycine max] Length = 160 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 91 MVDPAERRYLEDEDSSLMKTIKGATTGLVA 2 MVD AERRYLED+DSSLMKTIKGATTGLVA Sbjct: 1 MVDAAERRYLEDDDSSLMKTIKGATTGLVA 30