BLASTX nr result
ID: Wisteria21_contig00010307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010307 (422 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013450304.1| release factor glutamine methyltransferase [... 62 2e-07 ref|XP_004494303.1| PREDICTED: hemK methyltransferase family mem... 60 8e-07 ref|XP_003531487.1| PREDICTED: hemK methyltransferase family mem... 58 2e-06 >ref|XP_013450304.1| release factor glutamine methyltransferase [Medicago truncatula] gi|657380053|gb|KEH24332.1| release factor glutamine methyltransferase [Medicago truncatula] Length = 363 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 421 VDYMKSNKSGSLCNLKILPDFAGIQRFVIGFHQ 323 VDYMKSNKS SLCNL+I DFAGIQRFVIGFH+ Sbjct: 331 VDYMKSNKSASLCNLEIFADFAGIQRFVIGFHR 363 >ref|XP_004494303.1| PREDICTED: hemK methyltransferase family member 1 [Cicer arietinum] Length = 364 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 421 VDYMKSNKSGSLCNLKILPDFAGIQRFVIGF 329 VDYMKSNKS SLCNL+IL DFAGIQRFVIGF Sbjct: 332 VDYMKSNKSASLCNLEILADFAGIQRFVIGF 362 >ref|XP_003531487.1| PREDICTED: hemK methyltransferase family member 1-like isoform X1 [Glycine max] gi|947095137|gb|KRH43722.1| hypothetical protein GLYMA_08G167200 [Glycine max] Length = 361 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 421 VDYMKSNKSGSLCNLKILPDFAGIQRFVIGFHQ 323 VDYM++N+SGS CNL+I DFAGIQRFV+GFHQ Sbjct: 329 VDYMENNRSGSFCNLEIRADFAGIQRFVMGFHQ 361