BLASTX nr result
ID: Wisteria21_contig00010203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010203 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47291.1| unknown [Lotus japonicus] 62 2e-07 >gb|AFK47291.1| unknown [Lotus japonicus] Length = 211 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +2 Query: 101 MGSHTPTLELVREEIPVNQQPLRLSGDIKTGLVL 202 MGS TPTL+LV+EEIPV QQPLRLSGDIKTGLVL Sbjct: 1 MGSLTPTLQLVKEEIPVKQQPLRLSGDIKTGLVL 34