BLASTX nr result
ID: Wisteria21_contig00010202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010202 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47291.1| unknown [Lotus japonicus] 59 1e-06 >gb|AFK47291.1| unknown [Lotus japonicus] Length = 211 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 216 MGSHTPTIELVREEIPVNQQPLRLSGEIKTGLVL 317 MGS TPT++LV+EEIPV QQPLRLSG+IKTGLVL Sbjct: 1 MGSLTPTLQLVKEEIPVKQQPLRLSGDIKTGLVL 34