BLASTX nr result
ID: Wisteria21_contig00009285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009285 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH55160.1| hypothetical protein GLYMA_06G234200 [Glycine max] 59 2e-06 gb|KHN36399.1| Homogentisate 1,2-dioxygenase [Glycine soja] 59 2e-06 ref|XP_003527216.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 59 2e-06 ref|XP_003540068.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 59 2e-06 >gb|KRH55160.1| hypothetical protein GLYMA_06G234200 [Glycine max] Length = 448 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 277 ESSFLDRDYYQCWIGLRSHFTVPETPRRNPTLNNG 173 ES FLD+DYYQCWIGL+SHFTV ET N L NG Sbjct: 413 ESPFLDQDYYQCWIGLKSHFTVTETSPENTNLRNG 447 >gb|KHN36399.1| Homogentisate 1,2-dioxygenase [Glycine soja] Length = 487 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 277 ESSFLDRDYYQCWIGLRSHFTVPETPRRNPTLNNG 173 ES FLD+DYYQCWIGL+SHF V +T NP+L NG Sbjct: 452 ESPFLDQDYYQCWIGLKSHFAVTKTSPENPSLGNG 486 >ref|XP_003527216.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Glycine max] Length = 455 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 277 ESSFLDRDYYQCWIGLRSHFTVPETPRRNPTLNNG 173 ES FLD+DYYQCWIGL+SHFTV ET N L NG Sbjct: 420 ESPFLDQDYYQCWIGLKSHFTVTETSPENTNLRNG 454 >ref|XP_003540068.1| PREDICTED: homogentisate 1,2-dioxygenase-like isoform X1 [Glycine max] gi|571493465|ref|XP_006592560.1| PREDICTED: homogentisate 1,2-dioxygenase-like isoform X2 [Glycine max] gi|947077357|gb|KRH26197.1| hypothetical protein GLYMA_12G158600 [Glycine max] gi|947077358|gb|KRH26198.1| hypothetical protein GLYMA_12G158600 [Glycine max] Length = 455 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 277 ESSFLDRDYYQCWIGLRSHFTVPETPRRNPTLNNG 173 ES FLD+DYYQCWIGL+SHF V +T NP+L NG Sbjct: 420 ESPFLDQDYYQCWIGLKSHFAVTKTSPENPSLGNG 454