BLASTX nr result
ID: Wisteria21_contig00009282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009282 (212 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013458264.1| 2-oxoacid dehydrogenase acyltransferase fami... 118 2e-24 ref|XP_012573398.1| PREDICTED: lipoamide acyltransferase compone... 114 3e-23 ref|XP_004508198.1| PREDICTED: lipoamide acyltransferase compone... 114 3e-23 gb|KRH02274.1| hypothetical protein GLYMA_17G028000 [Glycine max] 103 7e-20 gb|KRH02273.1| hypothetical protein GLYMA_17G028000 [Glycine max] 103 7e-20 ref|XP_006600361.1| PREDICTED: lipoamide acyltransferase compone... 103 7e-20 ref|XP_003550355.1| PREDICTED: lipoamide acyltransferase compone... 103 7e-20 ref|XP_007154297.1| hypothetical protein PHAVU_003G106700g [Phas... 102 1e-19 ref|XP_014508673.1| PREDICTED: lipoamide acyltransferase compone... 101 2e-19 ref|XP_014508672.1| PREDICTED: lipoamide acyltransferase compone... 101 2e-19 gb|KHN02951.1| Lipoamide acyltransferase component of branched-c... 100 3e-19 ref|XP_006584021.1| PREDICTED: lipoamide acyltransferase compone... 100 3e-19 ref|XP_003529559.1| PREDICTED: lipoamide acyltransferase compone... 100 3e-19 gb|KOM33486.1| hypothetical protein LR48_Vigan01g304200 [Vigna a... 100 7e-19 ref|XP_006342820.1| PREDICTED: lipoamide acyltransferase compone... 72 2e-10 gb|KHG22391.1| Lipoamide acyltransferase component of branched-c... 71 4e-10 ref|XP_009765993.1| PREDICTED: lipoamide acyltransferase compone... 71 4e-10 ref|XP_009622170.1| PREDICTED: lipoamide acyltransferase compone... 71 4e-10 gb|ACF17642.1| putative branched-chain alpha-keto acid dehydroge... 70 5e-10 emb|CDO98842.1| unnamed protein product [Coffea canephora] 70 6e-10 >ref|XP_013458264.1| 2-oxoacid dehydrogenase acyltransferase family protein [Medicago truncatula] gi|657390899|gb|KEH32295.1| 2-oxoacid dehydrogenase acyltransferase family protein [Medicago truncatula] Length = 520 Score = 118 bits (295), Expect = 2e-24 Identities = 58/69 (84%), Positives = 63/69 (91%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SNIL PGD+VKVGATLLKI +DE SCPS TFGDSENAKSPDSDQI Sbjct: 118 KATIEITSRYKGKVSNILHGPGDIVKVGATLLKILIDEPSCPSTTFGDSENAKSPDSDQI 177 Query: 32 LVNKSAFTT 6 VN+SAFTT Sbjct: 178 FVNESAFTT 186 >ref|XP_012573398.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X2 [Cicer arietinum] Length = 419 Score = 114 bits (285), Expect = 3e-23 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SN+L PGD+VKVGATLLKI +DES CPSM FGDSE AKSPDSDQI Sbjct: 18 KATIEITSRYKGKVSNVLHAPGDIVKVGATLLKILIDESPCPSMDFGDSEIAKSPDSDQI 77 Query: 32 LVNKSAFTT 6 +VN+ AFTT Sbjct: 78 IVNEPAFTT 86 >ref|XP_004508198.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X1 [Cicer arietinum] gi|828324558|ref|XP_012573397.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X1 [Cicer arietinum] Length = 519 Score = 114 bits (285), Expect = 3e-23 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SN+L PGD+VKVGATLLKI +DES CPSM FGDSE AKSPDSDQI Sbjct: 118 KATIEITSRYKGKVSNVLHAPGDIVKVGATLLKILIDESPCPSMDFGDSEIAKSPDSDQI 177 Query: 32 LVNKSAFTT 6 +VN+ AFTT Sbjct: 178 IVNEPAFTT 186 >gb|KRH02274.1| hypothetical protein GLYMA_17G028000 [Glycine max] Length = 391 Score = 103 bits (256), Expect = 7e-20 Identities = 54/69 (78%), Positives = 59/69 (85%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKISNIL VPGD+VKVG TLLKI VDES+ PS DSENAKSPD+DQ Sbjct: 114 KATIEITSRYKGKISNILYVPGDIVKVGETLLKILVDESTFPSGIPCDSENAKSPDTDQT 173 Query: 32 LVNKSAFTT 6 LVN+S FTT Sbjct: 174 LVNESVFTT 182 >gb|KRH02273.1| hypothetical protein GLYMA_17G028000 [Glycine max] Length = 486 Score = 103 bits (256), Expect = 7e-20 Identities = 54/69 (78%), Positives = 59/69 (85%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKISNIL VPGD+VKVG TLLKI VDES+ PS DSENAKSPD+DQ Sbjct: 114 KATIEITSRYKGKISNILYVPGDIVKVGETLLKILVDESTFPSGIPCDSENAKSPDTDQT 173 Query: 32 LVNKSAFTT 6 LVN+S FTT Sbjct: 174 LVNESVFTT 182 >ref|XP_006600361.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X2 [Glycine max] Length = 477 Score = 103 bits (256), Expect = 7e-20 Identities = 54/69 (78%), Positives = 59/69 (85%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKISNIL VPGD+VKVG TLLKI VDES+ PS DSENAKSPD+DQ Sbjct: 76 KATIEITSRYKGKISNILYVPGDIVKVGETLLKILVDESTFPSGIPCDSENAKSPDTDQT 135 Query: 32 LVNKSAFTT 6 LVN+S FTT Sbjct: 136 LVNESVFTT 144 >ref|XP_003550355.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X1 [Glycine max] gi|734319306|gb|KHN03346.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Glycine soja] gi|947052819|gb|KRH02272.1| hypothetical protein GLYMA_17G028000 [Glycine max] Length = 515 Score = 103 bits (256), Expect = 7e-20 Identities = 54/69 (78%), Positives = 59/69 (85%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKISNIL VPGD+VKVG TLLKI VDES+ PS DSENAKSPD+DQ Sbjct: 114 KATIEITSRYKGKISNILYVPGDIVKVGETLLKILVDESTFPSGIPCDSENAKSPDTDQT 173 Query: 32 LVNKSAFTT 6 LVN+S FTT Sbjct: 174 LVNESVFTT 182 >ref|XP_007154297.1| hypothetical protein PHAVU_003G106700g [Phaseolus vulgaris] gi|561027651|gb|ESW26291.1| hypothetical protein PHAVU_003G106700g [Phaseolus vulgaris] Length = 573 Score = 102 bits (254), Expect = 1e-19 Identities = 51/69 (73%), Positives = 58/69 (84%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SNIL PGD+VKVG TLLKI VD+S+ PS+T GDSE AKSPDSD+ Sbjct: 172 KATIEITSRYKGKVSNILYGPGDIVKVGETLLKILVDDSALPSVTLGDSETAKSPDSDKT 231 Query: 32 LVNKSAFTT 6 LVN FTT Sbjct: 232 LVNVPVFTT 240 >ref|XP_014508673.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X2 [Vigna radiata var. radiata] Length = 424 Score = 101 bits (251), Expect = 2e-19 Identities = 49/70 (70%), Positives = 58/70 (82%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SNILC PGD+VKVG TLLKI VD+S+ PS++ GDS N KSPDSD+ Sbjct: 23 KATIEITSRYKGKVSNILCGPGDIVKVGETLLKILVDDSASPSVSLGDSVNTKSPDSDKT 82 Query: 32 LVNKSAFTTA 3 VN + FT A Sbjct: 83 SVNVTVFTAA 92 >ref|XP_014508672.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X1 [Vigna radiata var. radiata] Length = 516 Score = 101 bits (251), Expect = 2e-19 Identities = 49/70 (70%), Positives = 58/70 (82%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SNILC PGD+VKVG TLLKI VD+S+ PS++ GDS N KSPDSD+ Sbjct: 115 KATIEITSRYKGKVSNILCGPGDIVKVGETLLKILVDDSASPSVSLGDSVNTKSPDSDKT 174 Query: 32 LVNKSAFTTA 3 VN + FT A Sbjct: 175 SVNVTVFTAA 184 >gb|KHN02951.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Glycine soja] Length = 515 Score = 100 bits (250), Expect = 3e-19 Identities = 53/69 (76%), Positives = 58/69 (84%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKIS+ L VPGD+VKVG TLLKI VDES+ PS T DSENAKSPDSDQ Sbjct: 114 KATIEITSRYKGKISSFLYVPGDIVKVGETLLKILVDESAFPSGTPCDSENAKSPDSDQT 173 Query: 32 LVNKSAFTT 6 LVN+S TT Sbjct: 174 LVNESVLTT 182 >ref|XP_006584021.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like isoform X2 [Glycine max] Length = 419 Score = 100 bits (250), Expect = 3e-19 Identities = 53/69 (76%), Positives = 58/69 (84%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKIS+ L VPGD+VKVG TLLKI VDES+ PS T DSENAKSPDSDQ Sbjct: 18 KATIEITSRYKGKISSFLYVPGDIVKVGETLLKILVDESAFPSGTPCDSENAKSPDSDQT 77 Query: 32 LVNKSAFTT 6 LVN+S TT Sbjct: 78 LVNESVLTT 86 >ref|XP_003529559.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like isoform X1 [Glycine max] gi|947102323|gb|KRH50815.1| hypothetical protein GLYMA_07G246000 [Glycine max] Length = 515 Score = 100 bits (250), Expect = 3e-19 Identities = 53/69 (76%), Positives = 58/69 (84%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKIS+ L VPGD+VKVG TLLKI VDES+ PS T DSENAKSPDSDQ Sbjct: 114 KATIEITSRYKGKISSFLYVPGDIVKVGETLLKILVDESAFPSGTPCDSENAKSPDSDQT 173 Query: 32 LVNKSAFTT 6 LVN+S TT Sbjct: 174 LVNESVLTT 182 >gb|KOM33486.1| hypothetical protein LR48_Vigan01g304200 [Vigna angularis] Length = 516 Score = 99.8 bits (247), Expect = 7e-19 Identities = 49/69 (71%), Positives = 56/69 (81%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGK+SNILC PGD+VKVG TLLKI VD+S PS++ GDS N KSPDSD+ Sbjct: 115 KATIEITSRYKGKVSNILCGPGDIVKVGETLLKILVDDSVSPSVSLGDSVNTKSPDSDKT 174 Query: 32 LVNKSAFTT 6 VN FTT Sbjct: 175 SVNVPVFTT 183 >ref|XP_006342820.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Solanum tuberosum] Length = 505 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSD 39 KATIEIT+RYKGKIS IL VPG +VKVG TLLKI VDE P+ T+ SE S +SD Sbjct: 130 KATIEITSRYKGKISQILHVPGSIVKVGETLLKIGVDEILDPTETYDASEKMTSVESD 187 >gb|KHG22391.1| Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Gossypium arboreum] Length = 498 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/57 (54%), Positives = 46/57 (80%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDS 42 KATIEIT+RYKG+++ +L VPG++VKVG TLLK++V+++ P +T + EN K PD+ Sbjct: 121 KATIEITSRYKGRVAQVLHVPGNIVKVGETLLKMAVEDTQVPLVTLSNLENEKQPDT 177 >ref|XP_009765993.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Nicotiana sylvestris] Length = 506 Score = 70.9 bits (172), Expect = 4e-10 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKIS IL VPG++VKVG TLLKI+VD+ P+ T SE S DSD I Sbjct: 131 KATIEITSRYKGKISQILHVPGNIVKVGETLLKIAVDDIPEPAETSDASEKMTSLDSDFI 190 >ref|XP_009622170.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Nicotiana tomentosiformis] gi|697136196|ref|XP_009622171.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Nicotiana tomentosiformis] gi|697136198|ref|XP_009622172.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial [Nicotiana tomentosiformis] Length = 506 Score = 70.9 bits (172), Expect = 4e-10 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSDQI 33 KATIEIT+RYKGKIS+I+ VPG +VKVG TLLKI+VDE P+ T SE S DSD I Sbjct: 131 KATIEITSRYKGKISHIVHVPGSIVKVGETLLKIAVDEIPEPTETSDASEKMTSLDSDFI 190 >gb|ACF17642.1| putative branched-chain alpha-keto acid dehydrogenase E2 subunit [Capsicum annuum] Length = 505 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/58 (65%), Positives = 42/58 (72%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAKSPDSD 39 KATIEIT+RYKGKIS IL VPGD+VKVG TLLKI +DE P T SE S +SD Sbjct: 131 KATIEITSRYKGKISQILHVPGDIVKVGETLLKIGIDEIPDPIETSDASEKMTSLESD 188 >emb|CDO98842.1| unnamed protein product [Coffea canephora] Length = 537 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/70 (52%), Positives = 48/70 (68%), Gaps = 4/70 (5%) Frame = -1 Query: 212 KATIEITNRYKGKISNILCVPGDVVKVGATLLKISVDESSCPSMTFGDSENAK----SPD 45 KATIEIT+RYKGK+S IL VPG++VKVG TLLK+ VDE++CP T +N D Sbjct: 135 KATIEITSRYKGKVSQILHVPGNIVKVGETLLKMIVDETACPMQTLHPLDNLNCNGLEGD 194 Query: 44 SDQILVNKSA 15 S ++ +SA Sbjct: 195 SPSSVLQRSA 204